KEGG   Ensifer sojae: SJ05684_c12900Help
Entry
SJ05684_c12900    CDS       T05052                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
esj  Ensifer sojae
Pathway
esj00010  Glycolysis / Gluconeogenesis
esj00020  Citrate cycle (TCA cycle)
esj00620  Pyruvate metabolism
esj01100  Metabolic pathways
esj01110  Biosynthesis of secondary metabolites
esj01120  Microbial metabolism in diverse environments
esj01130  Biosynthesis of antibiotics
esj01200  Carbon metabolism
Module
esj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SJ05684_c12900
   00020 Citrate cycle (TCA cycle)
    SJ05684_c12900
   00620 Pyruvate metabolism
    SJ05684_c12900
Enzymes [BR:esj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SJ05684_c12900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N DUF2118 QRPTase_N HlyD_2 ATP-synt_ab_Xtn Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ASY62745
UniProt: A0A249PAD9
LinkDB All DBs
Position
1242241..1243599
Genome map
AA seq 452 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAEEGEDVSTAAKGGNGAAAPASAAMDAAPVAPAGAPAPETAPA
SQPAAQAPAAAPVSQAPAPTDGKRIFSSPLARRLAREAGIDLSAIAGSGPYGRVVKKDVE
AAAAGGVAKPAAAPAPAAAPAPALAKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLQE
SKQTIPHFYVSVDCQLDALLALRSQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPD
ANVSWTDANMVKHKNADVGVAVSIPGGLITPIVRQAELKSLSAISNEMKDLGKRAKERKL
KPEEYQGGTTAVSNMGMMGVKNFAAVVNPPHATILAVGAGEERVVVKNKEMVIANMMTVT
LSTDHRCVDGALGAELLAAFKRYIENPMGMLV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaacatcaccatgccggccctctctccgacgatggaagaaggcaatctcgcg
aagtggctcgtcaaggaaggcgacaaggtcaaatccggcgacgtcatcgccgagatcgaa
accgacaaggcgacgatggaagtcgaagccgttgatgagggcacggtcgccaagatcgtc
gttccggccggcaccgagggcgtcaaggtcaatgcgctgatcgccgtcctcgcggaagag
ggcgaggatgtctcaaccgccgcaaagggcggcaacggtgcagccgccccggcatccgcc
gccatggatgcggctcctgtagcgcccgccggtgcgcccgcgcccgagacggcaccggcg
tcccagccggctgcacaggcgccggccgcagcaccggtatctcaggcgccggcacctacc
gatggaaagcgcatcttctcctcgccgctcgcccgtcgcctcgccagggaagcaggcata
gatctttccgcgatcgccggttccggcccctacggccgcgtcgtcaaaaaggatgtcgag
gctgccgctgccggaggtgtcgccaagcctgccgcggctcctgctccggccgcagcaccg
gccccggcgcttgccaagggcatgtcggaagatgccgtcctcaagctcttcgagccgggc
agctacgagctcgtcccgcacgacggcatgcgcaagacgatcgccaagcgcctgcaggaa
tcgaagcagacgatcccgcatttctatgtttccgtcgattgccagctcgacgcgctcctg
gcgctgcgttcccagctcaatgccgctgcccccgagaaggatggcaagccggtctacaag
ctctcggtcaacgacatggtcatcaaggcgctggcgctggcgcttcgcgatgttccggac
gcgaacgtctcctggaccgatgccaacatggtcaagcacaagaatgccgatgtgggcgtt
gccgtttccattccaggcggcctgatcacgccgatcgtccgccaggcggaactgaagagc
ctgtccgccatctccaacgagatgaaggatctcggcaagcgcgccaaggagcgcaagctg
aagccggaagagtaccagggcggaaccacggccgtctccaacatgggcatgatgggcgtc
aagaacttcgccgcggtcgtcaacccgccgcatgcgacgatcttggcggtcggtgccggc
gaggagcgagtcgtggtcaagaacaaagagatggtcatcgccaatatgatgaccgtgacg
ctctccacagaccatcgctgcgtcgatggcgcgctcggcgccgaattgctcgccgccttc
aagcgctacatcgaaaacccgatgggcatgctcgtctga

DBGET integrated database retrieval system