KEGG   Ensifer sojae: SJ05684_c13480Help
Entry
SJ05684_c13480    CDS       T05052                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
esj  Ensifer sojae
Pathway
esj00061  Fatty acid biosynthesis
esj00780  Biotin metabolism
esj01100  Metabolic pathways
esj01212  Fatty acid metabolism
Module
esj_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SJ05684_c13480
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SJ05684_c13480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:esj01004]
    SJ05684_c13480
Enzymes [BR:esj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SJ05684_c13480
Lipid biosynthesis proteins [BR:esj01004]
 Fatty acid synthase
  Component type
   SJ05684_c13480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ASY62803
UniProt: A0A249PA40
LinkDB All DBs
Position
1300930..1301403
Genome map
AA seq 157 aa AA seqDB search
MARMNEAATVLGTADIQEILTLLPHRYPFLLVDRIIEIDDDNSAIGIKNVTANEPHFTGH
FPEKPIMPGVLLIEGMAQTAGAICARKTGIGSNLVYFMTIDNARFRKPVVPGDRVEFHVV
KHKQRGNIWKFHCDAKVEGQLVAEADIGAMIVSKEDA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaggatgaatgaggctgcgacagttctcggcactgcggatattcaggagatcctc
acgcttcttcctcatcgctatccgttcctgctggtcgatcggatcatcgaaatcgatgac
gataactccgcgatcggcatcaagaacgtgacggcgaacgagccgcacttcaccggtcat
ttcccggaaaagccgatcatgcccggtgtattgctgatcgaaggcatggcccagaccgca
ggggcgatttgtgcgcgcaagacgggcatcggcagcaatctcgtctacttcatgacgatc
gacaatgcgcgtttccgcaagccggtggtgcccggcgaccgcgtggagtttcacgtcgtc
aagcacaagcagcggggcaatatctggaaatttcattgtgatgcaaaagttgaggggcaa
ctggtcgcggaagctgatatcggcgcgatgatagtcagcaaggaagacgcctga

DBGET integrated database retrieval system