KEGG   Ensifer sojae: SJ05684_c22540Help
Entry
SJ05684_c22540    CDS       T05052                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
esj  Ensifer sojae
Pathway
esj00473  D-Alanine metabolism
esj00550  Peptidoglycan biosynthesis
esj01100  Metabolic pathways
esj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SJ05684_c22540
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SJ05684_c22540
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SJ05684_c22540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:esj01011]
    SJ05684_c22540
Enzymes [BR:esj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SJ05684_c22540
Peptidoglycan biosynthesis and degradation proteins [BR:esj01011]
 Precursor biosynthesis
  Amino acid ligase
   SJ05684_c22540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 GARS_A ATPgrasp_ST CPSase_L_D2 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ASY63695
UniProt: A0A249PD46
LinkDB All DBs
Position
complement(2179143..2180015)
Genome map
AA seq 290 aa AA seqDB search
MSLSSGAACADALEAEGYRVARVDVGRDVAAVLAELRPDVAFNALHGPFGEDGTIQGILE
YLEIPYTHSGVLASALAMDKAQAKHVAKAAGIPVAEALVMDRHAFGSDHPMKPPYVVKPV
REGSSFGVVIVKEDQSHPPQVITSSDWRYGDRVMVERYVAGRELTCGVMGDMALGVTEII
PQGHAFYDYDSKYVKGGSRHVIPAEISPNIYQKIQTLALKAHQAIGCRGVSRSDFRFDDR
GDGEGELIWLEINTQPGMTPTSLVPEMAQHAGLQFGEFLRWMVEDASCLR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgtcttccggggcagcttgcgcggacgctctggaagccgagggttatcgcgtt
gcgcgcgtcgatgtcgggcgcgatgttgcggcggtacttgcggaacttcgcccggatgtc
gccttcaacgcgctccacggccccttcggcgaggacggcacgatccagggcattctggag
tatctggaaattccctatacgcattccggcgtgctcgcctccgcgctcgccatggacaag
gcgcaggccaagcatgtcgccaaggctgccggcatacccgttgccgaagcgttggtgatg
gatcgacatgctttcggcagcgatcatccgatgaagccgccctacgtggtcaagccggtg
cgcgaaggctcgagcttcggcgtcgtcatcgtcaaggaggatcagtcgcatccgccccag
gtcatcacgtcgagcgattggcgttacggcgaccgggtcatggtcgagcgctatgtcgcc
gggcgtgaactcacttgcggcgtgatgggcgacatggctctcggcgttactgaaatcatc
ccgcagggtcacgccttttacgactatgattccaaatacgtaaaaggtggctcaagacac
gtcattcccgctgagatttcaccaaatatttaccaaaaaatacaaacactcgcattgaag
gcgcatcaggcaatcggctgccgcggcgtcagtcgttccgacttccgtttcgatgatcgt
ggcgacggcgagggcgagcttatctggctggagatcaacacccagcccggcatgactccg
acctccctggtgcccgaaatggcgcagcatgcaggccttcagtttggcgagtttctcagg
tggatggtggaggacgcatcgtgcttgcgttga

DBGET integrated database retrieval system