KEGG   Ensifer sojae: SJ05684_c23970Help
Entry
SJ05684_c23970    CDS       T05052                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
esj  Ensifer sojae
Pathway
esj00010  Glycolysis / Gluconeogenesis
esj00620  Pyruvate metabolism
esj01100  Metabolic pathways
esj01110  Biosynthesis of secondary metabolites
esj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SJ05684_c23970
   00620 Pyruvate metabolism
    SJ05684_c23970
Enzymes [BR:esj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SJ05684_c23970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASY63837
UniProt: A0A249PDS0
LinkDB All DBs
Position
complement(2327837..2329345)
Genome map
AA seq 502 aa AA seqDB search
MLHQKIVESPFKAKYGNFIGGEWREPVSGRYFENTTPITGGTICQVARSDAADIELALDA
AHATKEKWGRTSTTERSNILMKIAARMEDNLELLARAESFDNGKPIRETMAADIPLAIDH
FRYFAACIRAQEGSIGEIDHDTIAYHFHEPLGVVGQIIPWNFPILMAAWKVAPALAAGNC
VVLKPAEQTPASILVLAELIADLLPPGVLNIVNGFGLEAGKPLATSPRIAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVLNEEDDYFDKALEGFAMFALNQGEVCTCP
SRALVQESIYDRFMERAVKRVEAIRQGNPLDPATMIGAQASSEQLEKILAYIDIGKQEGA
EVLTGGARNELEGELAGGYYVQPTVFSGHNKMRIFQEEIFGPVVSVTTFKTEEEALAIAN
DTLYGLGAGVWSRDANRCYRFGRDIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LEHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcagaagatcgtcgagagcccgttcaaggcgaaatacggaaacttcatcggg
ggcgagtggcgcgagccggtctccgggcgctatttcgaaaacacgacgccgatcaccggc
ggcacgatttgccaagtcgcccgttcggatgcggccgatatcgaactggcgctcgatgcg
gcccacgccaccaaggagaagtggggccggacctcgaccaccgaacgctccaacatcctg
atgaagatcgcggcgcgcatggaggacaatctggagctcctggcgcgggccgagagcttc
gacaacggcaagccgatccgcgagacgatggcggcggacattccgctggcgatcgaccat
ttccgctattttgccgcctgcattcgcgcgcaggaaggctcgatcggcgagatcgatcac
gacacgatcgcctatcatttccacgagccgctcggcgttgtcggccagatcattccctgg
aacttcccgatcctgatggccgcctggaaggtggcgccggcgcttgccgccggcaactgt
gtcgtgctgaaacccgccgagcagacgccggcctccattctcgtgcttgccgaactcatc
gccgacctcctgccgccgggcgtgctcaacatcgtcaacggcttcggtctcgaagccgga
aagccgctcgccaccagccctcgcatcgccaagatcgccttcaccggcgagacgaccacc
ggccggttgatcatgcaatatgccagccagaacctcatcccggtgacgctggagcttggc
ggcaagtcgccgaacatcttctttgccgacgtgctcaacgaggaagacgattatttcgac
aaggcgctcgagggcttcgccatgtttgcgctcaaccagggcgaggtctgcacctgcccg
agccgtgcgctggttcaggaaagcatctacgaccgcttcatggagcgggcggtcaagcgg
gtcgaggcgatccgccagggcaatccgctcgatcccgcgacgatgatcggcgcgcaggcc
tcgagcgaacagctcgaaaagatcctcgcctatatcgatatcggcaagcaggaaggggcc
gaagtgctgacgggcggagcgcgcaacgagctcgagggcgagcttgcgggaggctactac
gtccagccgaccgtgttcagcggccacaacaagatgcgtatcttccaggaggaaatcttc
gggccggtcgtatcggtgacgaccttcaagaccgaggaggaggcgctggcgatcgccaac
gacacgctctacggcttgggtgccggcgtctggagccgagacgccaaccgttgctaccgc
ttcggccgcgacatccaagccggccgcgtctggaccaattgctatcatgcctatccggcc
cacgcggcattcggcggttacaagcaatcgggcatcggccgcgagacgcacaagatgatg
ctggagcattaccagcagacgaagaacatgctggtgagctacagcccgaaggcgctcggc
tttttctga

DBGET integrated database retrieval system