KEGG   Ensifer sojae: SJ05684_c24440Help
Entry
SJ05684_c24440    CDS       T05052                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
esj  Ensifer sojae
Pathway
esj00240  Pyrimidine metabolism
esj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SJ05684_c24440
Enzymes [BR:esj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SJ05684_c24440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ASY63884
UniProt: A0A249PDY1
LinkDB All DBs
Position
complement(2375874..2376458)
Genome map
AA seq 194 aa AA seqDB search
MAKLYFSYATMNAGKSTLLLQASYNYQERGLRVAMLIAAFDHRAGVGRIASRIGLDSEAI
PFHRADDLYALVERMNGDGSGEIACVFVDEAQFLGEDQVWQLARVADRLGIPVMAYGLRT
DFQGKLFPGSMALLAIADELREVRTICPCGRKATMVVRLDHEGNVVREGAQVDVGGNEKY
VSYCRRHWEELMEG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcagctacgcgacgatgaatgcgggcaagagcacgctgctgctg
caggcgtcctacaattaccaggagcgcggcctgcgcgtcgcgatgctgatcgccgctttc
gaccatcgcgccggcgttggccggatcgcctcgcgcatcgggctcgattcggaggcgatc
ccgttccaccgggcggatgatctctacgccctcgtcgagcgcatgaacggcgacggttcc
ggcgagatcgcctgcgttttcgtggacgaggcgcaattccttggagaggaccaggtctgg
cagctcgcgcgggtggccgatcgtctcggtatccccgtcatggcctacggcctgaggacg
gatttccagggcaagctctttcccggctcgatggcgctgctcgcaattgccgacgagctg
cgcgaggtgcgaacgatctgcccttgcggccgcaaggcgacgatggtcgtgcgcctcgac
cacgagggcaatgtcgtgcgcgagggggcgcaagttgatgtcggcggcaacgaaaaatat
gtgtcctattgccgccgccattgggaagagctgatggaggggtga

DBGET integrated database retrieval system