KEGG   Ensifer sojae: SJ05684_c30990Help
Entry
SJ05684_c30990    CDS       T05052                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
esj  Ensifer sojae
Pathway
esj00564  Glycerophospholipid metabolism
esj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:esj00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SJ05684_c30990
Enzymes [BR:esj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SJ05684_c30990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox_2 K_oxygenase NAD_binding_8 FAD_binding_3 GIDA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ASY64523
UniProt: A0A249PEZ7
LinkDB All DBs
Position
3048347..3049864
Genome map
AA seq 505 aa AA seqDB search
MSDQKVFDVFVIGGGINGCGIARDAAGRGYSVALAEMNDFASGTSSGSTKLIHGGLRYLE
YYEFRLVREALMEREVLWAMAPHVIWPMRFVLPYHKGGPRPAWLIRLGLFLYDHIGGRKL
LPATSTLDMTRDPAGEPLKRLFTKAFEYSDGWVDDARLVVLNARDAADRGARIMARTRVV
SARREGGVWAIEVENAVTGTRETLRARMLVNATGPWVDRVLSDALHKKDVHNVRLVQGSH
IVVKKKFDDPRAYFFQNPDGRIMFAIPYQGDFTLIGTTDRDFGGNPAEARISDAEIDYLC
KAASEYFAGPVTRDDIVWSYSAVRPLYDDGASKAQEATRDYVLRLEGEPGATPLLNVFGG
KLTTYRRLAESALDKIGEAIGVRGGKWTASSHLPGGDFPPTAYEAEVEKLKRRYPFLTAS
HARRLVRLYGTFAARLLGKAASRADLGKHFGGDLYAVEVDWLIEREWARRAEDVLWRRTK
LGLQLSRAEAAELEDYMRGAVNAAA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaccagaaagtcttcgacgtctttgtcataggcggcggcatcaacggatgcggc
atcgcgcgtgatgcggccggccggggctattccgtcgcgctggccgagatgaacgatttc
gcctccggcacctcgtccggctccaccaagctcatccatgggggcctgcgctatctcgaa
tattacgagttccgccttgtgcgcgaggcgctgatggagcgcgaagtgctttgggccatg
gcgccgcatgtcatctggccgatgcgattcgtgctgccctaccataagggcggaccgcgc
ccggcctggctgatacggctggggctgtttctctatgaccatatcggcggccgcaagctg
ctgccggcaacgagcacgctggacatgacccgcgatcccgccggcgagccgttgaagcgc
ctcttcaccaaggctttcgaatattccgacggctgggtggacgacgcccgcctcgtggtg
ctcaacgcgcgtgacgctgccgaccgcggcgcacgcatcatggcgcgcacccgcgtcgtc
tcggcccgccgcgagggaggcgtctgggctatcgaggtcgaaaacgcagtgaccggcacc
cgcgaaacgctccgcgcccgcatgctcgtcaatgccaccggcccctgggtggaccgggtg
cttagcgacgcgctgcacaagaaggacgtgcacaatgtccgcctcgtccagggtagccat
atcgtcgtgaagaagaagtttgacgacccgcgcgcctatttcttccagaatccggacggg
cgcatcatgttcgccatcccttaccagggcgatttcaccctgatcggaacgaccgaccgg
gacttcggcggcaatccggcggaagcgcgtatcagcgatgcggagatcgactatctctgc
aaggctgcgagcgagtacttcgccggcccggtgacccgcgacgacatcgtctggagctat
tcggccgtgcgcccgctctatgatgacggcgcgagcaaggcacaggaagcaacccgcgac
tatgtgctgcggctcgagggcgagcccggagcgaccccgcttctcaacgttttcggcggc
aagctcacgacctatcggcggcttgccgaatccgcgctcgacaagatcggcgaggcgatc
ggcgtcaggggcgggaaatggaccgcctcgtcgcacctgccgggcggcgacttccctccg
accgcctacgaggcggaggtggagaagctgaaacgacgctacccttttctcaccgcgtcg
cacgctcgccggcttgtccggctttatgggactttcgcggcgcggctcctcggcaaagcg
gcaagcagggccgacctcggcaagcacttcggcggcgatctttacgcggtcgaggtcgac
tggctgatcgaacgggaatgggcgcggcgcgcggaggacgtgctgtggcgccgcacgaag
ctgggattgcagctctcgcgggctgaagccgcggaactggaggattacatgcgcggcgcc
gtcaacgccgccgcctag

DBGET integrated database retrieval system