KEGG   Ensifer sojae: SJ05684_c31270Help
Entry
SJ05684_c31270    CDS       T05052                                 

Definition
(GenBank) Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
esj  Ensifer sojae
Pathway
esj00010  Glycolysis / Gluconeogenesis
esj00020  Citrate cycle (TCA cycle)
esj00260  Glycine, serine and threonine metabolism
esj00280  Valine, leucine and isoleucine degradation
esj00310  Lysine degradation
esj00380  Tryptophan metabolism
esj00620  Pyruvate metabolism
esj00630  Glyoxylate and dicarboxylate metabolism
esj00640  Propanoate metabolism
esj01100  Metabolic pathways
esj01110  Biosynthesis of secondary metabolites
esj01120  Microbial metabolism in diverse environments
esj01130  Biosynthesis of antibiotics
esj01200  Carbon metabolism
Module
esj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
esj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
esj_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
esj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SJ05684_c31270
   00020 Citrate cycle (TCA cycle)
    SJ05684_c31270
   00620 Pyruvate metabolism
    SJ05684_c31270
   00630 Glyoxylate and dicarboxylate metabolism
    SJ05684_c31270
   00640 Propanoate metabolism
    SJ05684_c31270
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SJ05684_c31270
   00280 Valine, leucine and isoleucine degradation
    SJ05684_c31270
   00310 Lysine degradation
    SJ05684_c31270
   00380 Tryptophan metabolism
    SJ05684_c31270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:esj04147]
    SJ05684_c31270
Enzymes [BR:esj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SJ05684_c31270
Exosome [BR:esj04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SJ05684_c31270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA NAD_binding_8 FAD_binding_2 K_oxygenase HI0933_like AlaDh_PNT_C FAD_binding_3 DAO Amino_oxidase 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ASY64551
UniProt: A0A249PF43
LinkDB All DBs
Position
complement(3077552..3078958)
Genome map
AA seq 468 aa AA seqDB search
MAYDLIVIGSGPGGYVCAIKAAQLGMKVAVIEKRSTYGGTCLNVGCIPSKALLHASEMFN
HAAHGLDALGVEVASPKLNLEKMMAHKDATVKANVDGVSFLFKKNKIDGFKGLGKVLGQG
KVSVTDDMGEEQILEAKNVVIATGSDVAGIPGVDLEFDEKMIVSSTGALELEKVPASMIV
VGGGVIGLELGSVWARLGAKVTVVEYLDTILGGMDGEVSKQLHRMLTKQGIDIKLGAKVT
SVQKPGSGARVTFEPVKGGESTALEAEVVLVATGRKPCTENMGLAKAGVVLDSRGRIEID
NHFQTSITGVYAIGDVVRGPMLAHKAEDEGVAVAEIIAGQAGHVNYDVIPGVVYTQPEVA
SVGKTEEELKAAGVAYKVGKFPFTANGRARAMLQTDGFVKILADKETDRVLGGHIIGFGA
GEMIHEIAVLMEFGGSSEDLGRTCHAHPTMSEAVKEAALATFAKPIHM
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgatctcatcgtaatcggaagcggcccgggtggctatgtctgcgccatcaag
gcggcccagctcggcatgaaggtcgccgtgatcgaaaagcgcagcacttatggcggcacc
tgcctgaatgtcggctgcatcccctccaaggctctgctgcacgcttccgagatgttcaac
cacgctgcgcatggcctcgatgcactgggcgtggaggtcgcaagcccgaagctcaatctc
gagaagatgatggcgcacaaggacgcaaccgttaaggcgaatgtcgacggcgtctccttc
ctcttcaagaagaataagatcgacgggttcaagggtctcggcaaggtgctgggccagggc
aaggtctccgtcaccgacgacatgggcgaggagcagatcctcgaagcgaagaacgtcgtc
atcgccaccggttcggatgtcgccggcattccgggcgtcgatctcgagttcgacgagaag
atgatcgtctcctcgactggcgcgctggagctggaaaaggtgccagcgagcatgatcgtg
gtcggcggcggcgtcattggcctcgaactcggctcggtttgggcgcgcctcggcgccaag
gtaacggtcgtcgagtatctcgacacgatcctcggcggcatggatggcgaagtctccaag
cagctccaccggatgctgacgaagcaaggcatcgacatcaagctcggcgccaaggtgacc
agcgtccaaaaaccgggctctggcgcgagagtcaccttcgagccggttaagggtggtgaa
tcgacggcgctcgaggccgaggtcgtgctggtcgcgaccggccgcaagccctgcacggag
aatatgggcctcgcgaaagccggcgtcgtgctcgattcgcgtggccgcatcgagatcgac
aatcacttccagacgagtatcaccggcgtctacgcgatcggcgacgtcgtgcgcggtccg
atgctcgcgcacaaggccgaggacgagggcgtggccgttgccgagatcatcgcggggcag
gcgggccacgtgaattacgacgtcattccgggcgtcgtctatacccagccggaggtcgcc
tccgtcggcaagaccgaggaggaactgaaggccgcaggcgtagcctacaaggtcggcaag
ttccccttcaccgccaatggccgcgcccgcgcgatgcttcagacggacggattcgtgaag
atcctcgccgacaaggaaaccgatcgcgtgctcggcggccatatcatcggcttcggcgcc
ggcgaaatgatccacgagatcgccgttttgatggagttcggcggctcgtcggaagacctc
ggccgcacctgccatgcgcatccgaccatgtcggaggcggtcaaggaggcggcgctcgcg
accttcgccaagccgatccacatgtga

DBGET integrated database retrieval system