KEGG   Ensifer sojae: SJ05684_c31390Help
Entry
SJ05684_c31390    CDS       T05052                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
esj  Ensifer sojae
Pathway
esj00020  Citrate cycle (TCA cycle)
esj00190  Oxidative phosphorylation
esj00650  Butanoate metabolism
esj01100  Metabolic pathways
esj01110  Biosynthesis of secondary metabolites
esj01120  Microbial metabolism in diverse environments
esj01130  Biosynthesis of antibiotics
esj01200  Carbon metabolism
Module
esj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
esj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
esj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SJ05684_c31390
   00650 Butanoate metabolism
    SJ05684_c31390
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SJ05684_c31390
Enzymes [BR:esj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SJ05684_c31390
    1.3.5.4  fumarate reductase (quinol)
     SJ05684_c31390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer2
Motif
Other DBs
NCBI-ProteinID: ASY64563
UniProt: A0A249PF37
LinkDB All DBs
Position
complement(3091817..3092596)
Genome map
AA seq 259 aa AA seqDB search
MVELALPKNSQITEGRVWPKPAGATNFREYRVYRWNPDDGKNPRIDTYYIDVDDCGPMVL
DGLLYIKNNIDPTLTLRRSCREGICGSCAMNIDGTNTLACTKGMDEVTGAVKIYPLPHMP
VVKDLVPDLTNFYAQHRSIEPWLKTVSPTPAKEWRQSHEDRAKLDGLYECILCACCSTSC
PSYWWNGDRYLGPAVLLQAYRWLIDSRDEATGERLDNLEDPFRLYRCHTIMNCAQACPKG
LNPAKAIGEIKKMLVERRF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaactcgctcttcccaagaactcgcagatcaccgaaggccgggtctggccgaaa
ccggccggcgcgacgaatttccgtgaataccgggtctatcgctggaatccggacgacggc
aagaacccgcggatcgatacctattatatcgatgtcgacgattgcgggccgatggtgctc
gacgggctgctctacatcaagaacaacatcgatccgacgctgaccttgcgccgctcctgt
cgcgagggcatctgcggttcctgcgcgatgaacatcgacggcaccaatacgctcgcctgc
accaaggggatggatgaggttacgggtgcggtgaagatctatccgctgccgcacatgccc
gtggtcaaggacctcgttccggatctcaccaatttctacgcccagcaccggtcgatcgag
ccctggctgaagacggtctcgccgacgccggccaaggaatggcggcagagccatgaggac
cgcgccaagctcgacgggctttatgagtgcattctctgcgcctgctgctcgacctcctgt
ccgagctactggtggaacggcgaccgctatctcggtcccgccgtcctgctgcaggcttat
cgctggctgatcgactccagagacgaggcaaccggcgagcggctcgacaatctcgaggac
ccgtttcggctctatcgctgccacacgatcatgaactgtgctcaggcctgtccgaagggt
ctgaacccggcgaaggcgatcggcgagatcaagaagatgctcgtcgagcggcggttctga

DBGET integrated database retrieval system