KEGG   Ensifer sojae: SJ05684_c34120
Entry
SJ05684_c34120    CDS       T05052                                 

Definition
(GenBank) Sensor histidine kinase ChvG
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
esj  Ensifer sojae
Pathway
esj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:esj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SJ05684_c34120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:esj01001]
    SJ05684_c34120
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:esj02022]
    SJ05684_c34120
Enzymes [BR:esj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SJ05684_c34120
Protein kinases [BR:esj01001]
 Histidine kinases
  OmpR family
   SJ05684_c34120
Two-component system [BR:esj02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   SJ05684_c34120
SSDB
Motif
Pfam: Stimulus_sens_1 Sensor_TM1 HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3
Other DBs
NCBI-ProteinID: ASY64834
UniProt: A0A249PGN6
LinkDB
Position
complement(3380777..3382558)
AA seq 593 aa
MEVLRGEIDDLDGRTSALRGQRRWAHPFTLIRRLFGNAVFSSLTRRIVFFNLVALIVLVG
GIMYLNQFREGLIDARVESLLTQGEIIAGAISASASVDTNSITIDPEKLLELQAGESITP
LPSDEDLEFPIIQERVAPVLRRLISPTRTRARLFDADADLLLDSRHLYSGGQVLRFDLPP
VDPETPSIMEAIGTWFNRLLQPSDLPLYKEPPGGNGSVYPEVMNALTGVRGAVVRVNEKG
ELIVSVAVPVQRFRAVLGVLLLSTQAGDIDKIVHAERLAIIRVFGVAALVNVILSLLLSS
TIANPLRRLAAAAIRVRRGAKEREEIPDFSSRQDEIGNLSIALREMTTALYDRIAAIENF
AADVSHELKNPLTSLRSAVETLPLARTEDSKKRLLDIIQHDVRRLDRLISDISDASRLDA
ELARSDAKKIDLEKLLGDLVDISRQVRGSKKPVLLDFVIDRKDNPKANFFVSGYELRIGQ
IVTNLIENARSFVPEPSGRIIVRLSRSRSRCIVTIEDNGPGIQAEDIDRIFERFYTDRPE
GEDFGQNSGLGLSISRQIAEAHGGTLKAENIAGKGGLVAGARFILSLPAEQNA
NT seq 1782 nt   +upstreamnt  +downstreamnt
gtggaagtcttgcgtggcgaaatcgacgatttggacgggagaacctccgcgctgcgcggc
cagcgccggtgggcgcatccgttcacgctgatccgccgcctgttcggcaacgccgtcttt
tcgagcctgacgcggcggattgtcttcttcaacctcgtcgcgctgatcgtgctcgtcggc
gggatcatgtatctcaaccagttccgcgagggcctcatcgacgcccgcgtggagagcctg
ctgacgcagggcgagatcatcgccggcgcgatttcggcctcggcatcggtcgacacgaac
tcgatcaccatcgatccggaaaagctgctggagttgcaggccggcgaaagcatcacgccg
ctgccgagcgacgaagacctcgaattcccgatcatccaggagcgggtcgcgccggttctc
cgcaggctcatctcaccgacgcgcacgcgcgcccgcctcttcgacgccgacgccgatctg
ctgctcgactcgcgccatctctatagcggcggtcaggtgcttcgcttcgacctgccgccg
gtcgatccggaaacgcccagcatcatggaggcgatcggcacctggttcaaccggctctta
cagccgagcgacctgccgctctacaaggagccgccgggcggcaacggctccgtctatccg
gaggtaatgaacgcgctgaccggcgtgcgcggcgcggtcgtgcgcgtcaacgaaaagggc
gaactgatcgtgtccgtggcggtgccggtgcagcgcttccgcgcggtgctcggcgtgctg
ctgctctccacccaggccggcgacatcgacaagatcgtccatgccgagcgcctggcgatc
atccgcgtcttcggcgtcgccgcactcgtcaacgtcattctgtcgctgctcctctcctcg
accatcgccaatccgctgaggcgactcgcggcggccgccatccgcgtgcgccgcggcgcc
aaggaacgcgaggaaatccccgacttctcctcccgccaggacgagatcggcaatctctcg
atcgcgctccgggaaatgacgacggcactctacgaccgcatcgccgcgatcgaaaatttc
gctgccgacgtcagccatgagctgaaaaatccgctgacctcgctgcgcagtgcggtggag
accctgccgctcgcacgcacggaggactccaagaagcggctgctcgatatcatccagcac
gatgtcaggcgcctcgaccgcctgatcagcgatatttcggatgcctcgcggctcgacgcc
gagctcgcccgcagcgatgcgaagaagatcgacctcgaaaagctcctcggcgacctcgtc
gatatctcgcggcaggtccgcggcagcaagaagcccgtgctgctcgatttcgtcatcgac
cgcaaggacaatccgaaggcgaatttcttcgtcagcggctacgagttgcgtatcggccag
atcgtcaccaatctcatcgagaatgcgcgctccttcgttccagagccaagcggccgcatc
atcgtgcggttgagccggtctagatcgcgctgcatcgtcaccatcgaggacaacggaccc
ggcatacaggcagaggatatagaccggatcttcgagcggttctacaccgaccggccggaa
ggcgaggacttcggccagaactccggcctgggcctgtcgatctcacgccagatcgccgag
gcgcatgggggcacgctgaaggccgagaacatcgccggcaagggcggcctggtggccggc
gcccgcttcatcctgtcgctaccggccgagcagaacgcatga

DBGET integrated database retrieval system