KEGG   Ensifer sojae: SJ05684_c36340Help
Entry
SJ05684_c36340    CDS       T05052                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
esj  Ensifer sojae
Pathway
esj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SJ05684_c36340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:esj02000]
    SJ05684_c36340
Enzymes [BR:esj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SJ05684_c36340
Transporters [BR:esj02000]
 Other Transporters
  Pores ion channels [TC:1]
   SJ05684_c36340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_5 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ASY65047
UniProt: A0A249PH42
LinkDB All DBs
Position
3603061..3603747
Genome map
AA seq 228 aa AA seqDB search
MNAHLTLISHHLCPYVQRAAIALAEKGVAFERVHIDLADKPDWFLKISPLDKVPLLRVPQ
EGGEAILFESSVICEYLEEALPGAKLHPSEPLNRARHRGWMEFGSSILSDLWIFETTQDA
ETLETKQKALRSKFATVEAELGDGPYFAGVGFSLVDAVFAPIFRYFDVFDRISDHGVFHG
LPRLRGWRQALSARPSVVTAVTEDYPERLLAFLKRHDAALLKARKIAA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcatctgaccctgatcagccaccatctctgcccctatgtgcagcgcgccgcc
attgcgcttgcggagaaaggcgttgcattcgagcgtgtccatatcgatcttgccgacaaa
cccgactggttcctgaagatctcgccgctcgacaaggtgccgctgctgcgcgtgccgcag
gagggcggggaggcgatcctcttcgaaagctcggtgatctgcgaatatctggaagaagcc
ctcccgggagcgaaactgcatccgtcagagccactgaacagggcacggcatcggggctgg
atggagttcggctcgtccattctgtccgatctctggatatttgagaccacgcaggacgcc
gagacgctcgagaccaagcagaaggctcttcggtccaaattcgcgaccgtcgaggcggag
cttggcgacgggccctattttgccggtgtcggtttcagcctggtcgacgccgtcttcgcc
ccgattttccgttacttcgacgtgttcgatcgtatctcggaccatggcgtctttcacggt
ctgccgcgccttcgcggctggcgccaagcgctgtcggcccggccgagcgtggtaacggcg
gtcacagaggattaccccgaacgactgctggcattcctgaaaaggcacgatgcagccttg
ctcaaggcacgaaagatcgccgcctga

DBGET integrated database retrieval system