KEGG   Escherichia coli O104 H4 2011C-3493: O3K_07255Help
Entry
O3K_07255         CDS       T02257                                 

Definition
(RefSeq) putative periplasmic esterase
  KO
K21469  serine-type D-Ala-D-Ala carboxypeptidase [EC:3.4.16.4]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:esl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    O3K_07255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:esl01002]
    O3K_07255
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:esl01011]
    O3K_07255
Enzymes [BR:esl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     O3K_07255
Peptidases [BR:esl01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   O3K_07255
Peptidoglycan biosynthesis and degradation proteins [BR:esl01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   O3K_07255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-GeneID: 13702906
NCBI-ProteinID: YP_006778159
UniProt: A0A0E0XVY7
LinkDB All DBs
Position
complement(1503289..1504593)
Genome map
AA seq 434 aa AA seqDB search
MKRTMLYLSLLAVSCSVSAAKYPVLTESSPEKAGFNVERLNQMDRWISQQVDAGYPGVNL
LIIKDNQIVYRKAWGAAKKYDGSVLMEQPVKATTGTLYDLASNTKMYATNFALQKLMSEG
KLHPDDRIAKYIPGFADSPNDTIKGKNTLRISDLLHHSGGFPADPQYPNKAVAGALYSQD
KGQTLEMIKRTPLEYQPGSKHIYSDVDYMLLGFIVESVTGQPLDRYVEESIYRPLGLTHT
VFNPLLKGFKPQQIAATELNGNTRDGVIHFPNIRTSTLWGQVHDEKAFYSMGGVSGHAGL
FSNTGDIAVLMQTMLNGGGYGDVQLFSAETVKMFTTSSKEDANFGLGWRVNGNATMTPTF
GTLASPQTYGHTGWTGTVTVIDPVNHMAIVMLSNKPHSPVADPQKNPNMFESGQLPIATY
GWVVDQVYAALKQK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggacaatgctctatctttctctgctggctgttagttgtagcgtcagcgccgca
aaataccctgttctgacagaaagttcgccagagaaagcagggttcaacgtcgaacggctt
aaccagatggatcgctggattagccagcaagtggacgccggttatcccggcgtaaacctg
ctgatcattaaagataatcagattgtgtatcgcaaagcctggggagcggcgaaaaagtac
gatggcagcgtgttgatggaacagcctgtcaaagccaccaccgggacgctgtatgacctg
gcctcaaacaccaaaatgtacgccacgaacttcgccctgcaaaagctgatgagcgaaggc
aaactgcatcctgacgatcggattgcgaaatatattccggggtttgccgatagtccaaat
gacaccattaaaggcaaaaacaccctgcggatttctgacctgctgcatcacagcggcggt
ttcccggcagatccgcaatacccgaataaagcggtcgcgggcgcgttatattcccaggat
aaaggccagacgctggagatgatcaagcgcacgccgctagagtatcagcccggcagcaag
catatttacagtgatgtcgattatatgctgcttggatttatcgtcgagtcggtcaccggt
cagccgcttgaccgctatgttgaagagtcgatttatcgcccgctcggcctgacacatacg
gtatttaacccgctgctgaaaggctttaaaccgcaacaaattgccgccacggaattgaac
ggcaatacccgcgatggcgtgatccatttcccgaatatccgcacctccactctctggggt
caggtgcacgatgaaaaagccttttattcgatgggcggcgtttccgggcacgcaggtttg
ttttccaataccggcgatattgcggtgttaatgcaaacgatgctgaacggcgggggctat
ggcgatgtgcagctgttcagtgcggaaacggtaaagatgtttaccaccagctctaaggaa
gatgccaattttggcctcggctggcgcgtgaatggtaatgccaccatgacgccgacgttt
ggcacgctggcaagcccgcaaacctacggtcacactggctggaccgggacagtaaccgtt
atcgatccggtcaatcatatggcgattgtgatgttaagcaacaagccccattcgccagtt
gccgatccacaaaaaaatcccaatatgttcgaaagcggtcagttaccgattgcaacttat
ggttgggtagttgatcaggtgtatgcggcgttgaagcaaaagtaa

DBGET integrated database retrieval system