KEGG   Escherichia coli O104 H4 2011C-3493: O3K_09995Help
Entry
O3K_09995         CDS       T02257                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl00500  Starch and sucrose metabolism
esl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    O3K_09995
Enzymes [BR:esl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     O3K_09995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-GeneID: 13699523
NCBI-ProteinID: YP_006778694
UniProt: A0A0E0XXL5
LinkDB All DBs
Position
complement(2093851..2095338)
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSIPTKYGDKAQLLAAIDALKRNDIAVLLDVVVNHKMGADEKEAIRVQRV
NADDRTQIDEEIIECEGWTRYTFPARAGQYSQFIWDFKCFSGIDHIENPDEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIDQVEGKTMLFDAPLQMKFHEAS
RMGRDYDMTQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDVGGDGQTYPIDMPIIEQLDELILARQRFAHGVQTLFFDHPNCI
AFSRSGTDEYPGCVVVMSNGDDGEKTIHLGENYGNKTWRDFLGNRQESVVTDENGEATFF
CNGGSVSVWVIEEVI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatcccacgctgttacaatgttttcactggtattacccggaaggcggtaagctc
tggcctgaactggccgagcgcgcagacggttttaatgatattggtatcaatatggtctgg
ttgccgcccgcctataaaggcgcatcgggcggctattcggtcggctacgactcctatgat
ttatttgatctaggtgagtttgatcagaaaggcagcatccctactaaatatggtgataaa
gcacaactgctggccgccattgacgccctgaaacgtaatgacattgcggtgctgctggac
gtggtagtcaaccacaaaatgggcgcggatgaaaaagaagctattcgcgtgcagcgtgta
aatgctgatgaccgtacgcaaattgacgaagaaatcattgagtgtgaaggctggacgcgt
tacaccttccccgctcgtgccgggcaatactcgcagtttatctgggatttcaaatgtttt
agcggtatcgaccatatcgaaaaccctgatgaagatggcatttttaaaattgttaacgac
tataccggagaaggctggaacgatcaggttgatgatgaactcggtaatttcgattatctg
atgggggagaatatcgattttcgcaatcatgccgtgacggaagagattaaatactgggcg
cgctgggtgatggaacaaacgcaatgcgacggctttcgtcttgatgcggtcaaacatatt
ccggcatggttttataaagagtggatcgaacacgtacaggaagttgcgccaaagccgttg
tttattgtggctgaatactggtcgcatgaagtcgataaactgcaaacgtatattgatcag
gtggaaggcaaaaccatgctgtttgatgcgccgctgcagatgaaattccatgaagcatcg
cgcatgggtcgcgactacgacatgacgcagatcttcactgggacgctggtggaagccgat
ccttttcacgccgtaaccctcgttgccaaccacgacacccaaccgttgcaagccctcgaa
gcccccgtcgaaccgtggtttaaaccgctggcgtatgccttaattttgttgcgggaaaat
ggcgttccttcggtgttctatccggacctctacggtgcacattacgaagatgtcggtggt
gacgggcaaacctatccgatagatatgccaataatcgaacagcttgatgagttaattctc
gcccgtcagcgtttcgcccacggtgtacagacgttatttttcgaccatccgaactgcatt
gcctttagccgcagtggcaccgacgaatatcccggctgcgtggtggtcatgtcgaacgga
gatgatggcgaaaaaaccattcatctgggagagaattacggcaataaaacctggcgtgat
tttctggggaaccggcaagagagcgtagtgacagacgaaaacggcgaagcgaccttcttt
tgcaacggcggcagcgtcagcgtgtgggttatcgaagaggtgatttaa

DBGET integrated database retrieval system