KEGG   Escherichia coli O104 H4 2011C-3493 (EAEC): O3K_12190
Entry
O3K_12190         CDS       T02257                                 

Definition
(RefSeq) sensor protein RstB
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
esl  Escherichia coli O104:H4 2011C-3493 (EAEC)
Pathway
esl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:esl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3K_12190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:esl01001]
    O3K_12190
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:esl02022]
    O3K_12190
Enzymes [BR:esl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     O3K_12190
Protein kinases [BR:esl01001]
 Histidine kinases
  OmpR family
   O3K_12190
Two-component system [BR:esl02022]
 OmpR family
  RstB-RstA
   O3K_12190
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3
Other DBs
NCBI-GeneID: 13701807
NCBI-ProteinID: YP_006779129
UniProt: A0A0E0XYS8
LinkDB
Position
complement(2504626..2505927)
AA seq 433 aa
MKKLFIQFYLLLFVCFLVMSLLVGLVYKFTAERAGKQSLDDLMNSSLYLMRSELREIPPH
DWGKTLKEMDLNLSFDLRVEPLSKYHLDDISMHRLRGGEIVALDDQYTFLQRIPRSHYVL
AVGPVPYLYYLHQMRLLDIALIAFIAISLAFPVFIWMRPHWQDMLKLEAAAQRFGDGHLN
ERIHFDEGSSFERLGIAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSDNL
SAAESQALNRDISQLEALIEELLTYARLDRPQNELHLSEPDLPLWLSTHLADIQAVTPDK
TVRIKTLAQGHYAALDMRLMERVLDNLLNNALRYCHSTVETSLLLSGNRATLIVEDDGPG
IAPENREHIFEPFVRLDPSRDRSTGGCGLGLAIVHSIALAMGGTVNCDTSELGGARFSFS
WPLWHNIPQFTSA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaaaaactgtttatccagttttacctgttattgtttgtctgcttccttgtgatgtct
ctgctggttgggttggtgtacaaatttaccgccgaacgcgcgggcaaacagtcgctggat
gatttgatgaacagttcgctgtatctgatgcgcagcgaattgcgtgagatccccccacac
gactggggtaagacgctgaaagagatggatttaaatctctctttcgatctgcgtgtcgag
ccattgagtaaataccatcttgatgatatttccatgcaccgactgcgtggcggcgaaatt
gtcgccctggacgatcagtacacgtttttgcagcgtatcccgcgcagccactacgtgctg
gcagttggtcctgttccttatctttattatctccatcagatgcgattgctggatatcgcc
ctgatcgcttttattgctatttccctcgcctttccggtgtttatctggatgcgtccgcac
tggcaggatatgttaaaactggaagcagcggcgcaacgatttggcgatgggcatctcaat
gagcgtatccactttgatgagggttcgagctttgaacgacttggtatcgcatttaaccag
atggcggacaatatcaacgccttgattgccagcaaaaaacagcttattgacggtatcgct
cacgaactgcgaacaccgttagtgcgcctgcgttatcgactggagatgagcgataacctg
agcgccgccgaatcccaggcgttgaatcgtgatatcagtcaacttgaagctttaattgaa
gagctgctgacttatgcccgactcgatcgcccacaaaacgagcttcatcttagcgaacca
gacctgccgttgtggctgtcaacgcatctggcagacattcaggcagtaacgcccgataaa
acggtacggattaaaacgctcgcgcaaggccattatgcggcgttggatatgcgcttaatg
gagcgcgtgctggataatttgctcaataacgccctgcggtactgccattcaacggttgaa
accagcctgctactgtcggggaatagagcgacattaattgttgaggatgatggcccaggg
attgccccagaaaaccgcgaacatatctttgaaccttttgttcgcctcgatcccagccgg
gatcgctcaaccggcggctgcgggctggggctggcaattgtccactctatagcactggca
atgggcggtacggttaattgtgacaccagcgaactgggtggtgctcgcttctcgtttagc
tggccgttatggcataacatcccgcaatttacctctgcctga

DBGET integrated database retrieval system