KEGG   Escherichia coli O104 H4 2011C-3493: O3K_13820Help
Entry
O3K_13820         CDS       T02257                                 

Definition
(RefSeq) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl00250  Alanine, aspartate and glutamate metabolism
esl00410  beta-Alanine metabolism
esl00640  Propanoate metabolism
esl00650  Butanoate metabolism
esl01100  Metabolic pathways
esl01120  Microbial metabolism in diverse environments
Module
esl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:esl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    O3K_13820
   00650 Butanoate metabolism
    O3K_13820
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O3K_13820
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    O3K_13820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:esl01007]
    O3K_13820
Enzymes [BR:esl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     O3K_13820
Amino acid related enzymes [BR:esl01007]
 Aminotransferase (transaminase)
  Class III
   O3K_13820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 13702409
NCBI-ProteinID: YP_006779450
UniProt: A0A0E0Y163
LinkDB All DBs
Position
complement(2842077..2843342)
Genome map
AA seq 421 aa AA seqDB search
MSNNEFHQRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPE
LVAAVEQQLQQFTHTAYQIVPYESYVTLAEKINALAPVSGQAKTAFFTTGAEAVENAVKI
ARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQ
DSLDAIERLFKSDIEAKQVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEV
QSGFARTGKLFAMDHYVDKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGN
PLAVAAAHAVLNIIDKESLCERANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAAEFND
PQTGKPSAAIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDVQFDAAMKILQDALS
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaattccatcagcgtcgtctttctgctaccccacgcggggttggcgtg
atgtgtaacttcttcgcccagtcggctgaaaacgccacgctgaaggatgttgagggcaac
gagtacatcgatttcgccgcaggcattgcggtgctaaataccggccaccgccaccctgaa
ctggtcgcggcggtagagcagcaactgcaacagtttacccacaccgcgtatcagattgtg
ccgtatgaaagctacgtcaccctggcggagaaaatcaacgcccttgccccggtgagcggg
caggccaaaaccgcgttcttcactaccggcgcggaagcggtggaaaacgcggtgaaaatt
gctcgcgcccataccggacgccctggcgtgattgcgtttagcggcggcttccacggtcgt
acgtatatgactatggcgttaactggaaaggtcgctccgtacaaaatcggcttcggcccg
ttccctggttcggtgtatcacgtaccttatccgtcagatttacacggcatttcaacacag
gactccctcgacgccatcgaacgcttgtttaaatcagacatcgaagcgaagcaggtggcg
gcgattattttcgaaccggtgcagggcgagggcggtttcaacgttgcgccaaaagagctg
gttgccgccattcgccgcctgtgcgacgagcacggcattgtgatgattgccgatgaagtg
caaagcggctttgcgcgtaccggtaagctgtttgccatggatcattacgtcgataagccg
gatttaatgacgatggcgaaaagcctcgcgggcgggatgccgctttcgggcgtggtcggt
aacgcgaatattatggacgcgcccgcgccgggcgggttgggtggcacctacgccgggaac
ccgctggcggtggctgccgcgcacgcggtgctcaatattatcgacaaagaatcactctgc
gaacgcgcgaatcaactgggccagcgtctcaaaaacacgttgattgatgccaaagaaagc
gttccggccattgctgcggtacgcggcctggggtcgatgattgcggcagagtttaacgat
ccgcaaacgggcaagccgtcagcggcgattgcacagaaaatccagcaacgcgcgctggcg
caggggctgctcctgctgacctgtggcgcatacggcaacgtgattcgcttcctgtatccg
ctgaccatcccggatgtgcaattcgatgcggcaatgaaaattttgcaggatgcgctgagc
gattaa

DBGET integrated database retrieval system