KEGG   Escherichia coli O104 H4 2011C-3493: O3K_19065Help
Entry
O3K_19065         CDS       T02257                                 

Definition
(RefSeq) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl00220  Arginine biosynthesis
esl00250  Alanine, aspartate and glutamate metabolism
esl00471  D-Glutamine and D-glutamate metabolism
esl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O3K_19065
   00220 Arginine biosynthesis
    O3K_19065
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    O3K_19065
Enzymes [BR:esl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     O3K_19065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-GeneID: 13702352
NCBI-ProteinID: YP_006780484
UniProt: A0A0E0Y2N4
LinkDB All DBs
Structure
PDB: 

Position
complement(3903913..3904845)
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGKVYSAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLLNTVELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGEWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEEGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcaggcttacacccaatttcactca
cttaacggcggtcaaaatgccgactacattccctttctggcgaatgtgcctggtcaactg
gcggcagtggctatcgtgacctgcgatggcaaggtctatagtgcgggtgacagtgattac
cgctttgcgctggaatccatctcgaaagtctgtacgttagcccttgcgttagaggatgtc
ggcccgcaggcggtacaggacaaaattggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctttcgccactggtaaatgctggcgcc
attgccaccaccagcctgattaacgctgaaaatgttgaacaacgctggcagcgaatttta
catatccaacagcaactggctggtgagcaggtagcgctctctgacgaagtcaaccagtcg
gaacaaacaaccaacttccataaccgggccattgcctggctgctgtactccgccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtacacccgtcagtgctccacgctcctc
aatactgttgaactggcaacacttggcgcgacgctggcggcggggggagtgaatccgctg
acgcataaacgcgttcttcaggccgataacgtgccgtacattctggccgaaatgatgatg
gaagggctgtatggtcgctccggtgagtgggcatatcgcgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgtccctggtgtgatgggaattgccgcgttctca
ccaccgctggacgaagaaggcaacagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system