KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_05005Help
Entry
O3M_05005         CDS       T02316                                 

Definition
(GenBank) 6-phospho-beta-glucosidase BglA
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Pathway
esm00010  Glycolysis / Gluconeogenesis
esm00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:esm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3M_05005
   00500 Starch and sucrose metabolism
    O3M_05005
Enzymes [BR:esm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     O3M_05005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AFS55715
LinkDB All DBs
Structure
PDB: 

Position
complement(1017456..1018889)
Genome map
AA seq 477 aa AA seqDB search
MKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKYYP
NHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDGMFDELL
KYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPEMKVGCML
AMVPLYPYCCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLD
VLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYAL
CELYERYQRPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgctcatcag
gtcgaaggcggctggaacaaaggcggcaaagggccgagcatttgtgacgttctgaccggt
ggcgcacacggcgtgccgcgcgaaatcaccaaagaagtcttgccaggcaaatactatcca
aaccatgaagccgttgatttttatggtcactacaaggaagacatcaagctatttgccgaa
atgggcttcaaatgttttcggacttccatcgcctggacgcgtatttttccaaaaggtgat
gaagctcagccaaacgaagaagggctgaagttctacgatggtatgttcgatgaactgctg
aaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcatctggtg
cagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtccgtttcgcggaa
gtggtgtttgaacgctataagcataaagtcaaatactggatgaccttcaacgaaattaac
aaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtttatacc
gagcatgagaacccggaagagacgatgtatcaggtgctgcatcaccagtttgtcgccagc
gccctggcggtgaaagctgcgcgtcgcattaacccggagatgaaagtcggctgtatgctg
gcgatggtgccgctctatccctactgctgtaacccggacgatgtgatgttcgctcaggag
tcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccgtcctat
gtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagacggcgatctcgat
gtactgcgtgaaggcacctgcgattatcttggtttcagctattacatgaccaacgcagtg
aaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtaccgaacccg
tatgttaaagcgtctgactggggctggcagattgatccagtaggtctgcgctatgccctt
tgcgaactgtatgagcgttatcagaggccgctgtttattgtcgaaaacggttttggcgct
tacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactacctgcgc
gcccatattgaagagatgaaaaaagcagtgacttacgatggtgtggatctgatgggctac
acaccgtggggctgcatcgactgcgtgtcattcactaccgggcagtacagcaaacgctat
ggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttcacgtaag
aagagctttaactggtacaaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system