KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_06285Help
Entry
O3M_06285         CDS       T02316                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Pathway
esm00250  Alanine, aspartate and glutamate metabolism
esm00280  Valine, leucine and isoleucine degradation
esm00410  beta-Alanine metabolism
esm00640  Propanoate metabolism
esm00650  Butanoate metabolism
esm01100  Metabolic pathways
esm01120  Microbial metabolism in diverse environments
Module
esm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:esm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    O3M_06285
   00650 Butanoate metabolism
    O3M_06285
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O3M_06285
   00280 Valine, leucine and isoleucine degradation
    O3M_06285
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    O3M_06285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:esm01007]
    O3M_06285
Enzymes [BR:esm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     O3M_06285
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     O3M_06285
Amino acid related enzymes [BR:esm01007]
 Aminotransferase (transaminase)
  Class III
   O3M_06285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AFS55963
LinkDB All DBs
Structure
PDB: 

Position
complement(1282011..1283291)
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHSKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaggtggtggccgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
ttcgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtaaaa
atcgcccgcgccgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgatgccgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgccgcgtcgccagcc
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgttgcg
ccggatctcactacctttgcgaaatcgatcgcgggcggcttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggatgccgtcgctccaggcggtctgggcggcacctatgccggt
aacccgattgcctgcgtggcggcgctggaagtgttgaaggtgtttgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaagctaaaagacggattgttggcgatagccgaa
aaacacccggagatcggcgacgtacgcgggctgggagcgatgattgccatcgagctgttt
gaagatggcgatcacagcaaaccggacgcaaaactcaccgccgagatcgtggcacgcgcc
cgcgataagggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system