KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_11060Help
Entry
O3M_11060         CDS       T02316                                 

Definition
(GenBank) putative iditol dehydrogenase
Organism
esm  Escherichia coli O104:H4 2009EL-2050
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2 Cupin_2 ThiF
Motif
Other DBs
NCBI-ProteinID: AFS56899
LinkDB All DBs
Structure
PDB: 

Position
2282175..2283218
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILQVPGTMKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIIILGAGCI
GLMTLQACKCLGATEIAVVDVLEKRLIMAEQLGATVVINGTKEDTIARCQQFTEDMGADI
VFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVTIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYRDVQQAFEESVNNKRDIIKGVIKISD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcaatattgcaggtgccgggcacaatgaaaattatttcagcagaa
ataccagtgcctaaagaagatgaagttttgattaaagtagaatatgtcggtatttgtggt
tcagatgtacatggttttgaatcaggcccgtttattccgcctaaagacccaaatcaagaa
attggcctgggtcatgaatgcgccgggacggttgtggctgtgggaagccgcgtgcgcaaa
tttaaaccgggggatcgggtaaatatcgaacctggcgttccttgcggtcactgtcgttac
tgtctggaaggcaaatataacatctgcccggacgttgattttatggcgacacaacccaac
taccgcggcgcattaacgcactatctgtgtcatccggagagctttacttacaaactgcca
gacaatatggacacgatggaaggggcgctggtggagcctgccgcagtcgggatgcatgcc
gcgatgctggcagatgttaaaccgggtaagaagataattattctgggagcaggttgtatt
ggtttgatgacgttgcaagcgtgcaaatgcctgggcgcaacggaaattgccgtcgttgat
gtgctggaaaaacgtctgataatggcggaacaacttggtgcgacagtggttattaacggc
acaaaagaagacactattgcacgctgtcagcaatttaccgaagacatgggcgcagatatt
gttttcgaaacagcgggttctgcggtcaccgttaaacaggcaccttatctggtaatgcgc
ggcggtaaaattatgattgttggtactgtacccggcgattcggcaatcaatttcctcaaa
atcaatcgcgaagtcactatccagacggtattccgctatgccaatcgttatccggtcacg
attgaagctatttcttcagggcgattcgatgtgaaatcgatggtgacgcatatttacgat
tatcgggatgtacaacaggcatttgaagagtcagttaacaacaaacgcgacattattaaa
ggcgttattaaaattagcgattaa

DBGET integrated database retrieval system