KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_13865Help
Entry
O3M_13865         CDS       T02316                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Pathway
esm00061  Fatty acid biosynthesis
esm00780  Biotin metabolism
esm01100  Metabolic pathways
esm01130  Biosynthesis of antibiotics
esm01212  Fatty acid metabolism
Module
esm_M00083  Fatty acid biosynthesis, elongation
esm_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:esm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    O3M_13865
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    O3M_13865
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    O3M_13865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:esm01004]
    O3M_13865
Enzymes [BR:esm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     O3M_13865
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     O3M_13865
Lipid biosynthesis proteins [BR:esm01004]
 Fatty acid synthase
  Component type
   O3M_13865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AFS57453
LinkDB All DBs
Structure
PDB: 

Position
2849358..2850146
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattctggtaaccggtgttgccagcaaactatccatc
gcctacggtatcgctcaggcgatgcaccgcgaaggagctgaactggcattcacctaccag
aacgacaaactgaaaggccgcgtagaagaatttgccgctcaattgggttctgacatcgtt
ctgcagtgcgatgttgcagaagatgccagcatcgacaccatgttcgctgaactggggaaa
gtttggccgaaatttgacggtttcgtacactctattggttttgcacctggcgatcagctg
gatggtgactatgttaacgccgttacccgtgaaggcttcaaaattgcccacgacatcagc
tcctacagcttcgttgcaatggcaaaagcttgccgctccatgctgaatccgggttctgcc
ctgctgaccctttcctaccttggcgctgagcgcgctatcccgaactacaacgttatgggt
ctggcaaaagcgtctctggaagcgaacgtgcgctatatggcgaacgcgatgggtccggaa
ggtgtgcgtgttaacgccatctctgctggtccgatccgtactctggcggcctccggtatc
aaagacttccgcaaaatgctggctcattgcgaagccgttaccccgattcgccgtaccgtt
actattgaagatgtgggtaactccgcggcattcctgtgctccgatctctctgccggtatc
tccggtgaagtggtccacgttgacggcggtttcagcatcgctgcaatgaacgaactcgaa
ttgaaataa

DBGET integrated database retrieval system