KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_24240Help
Entry
O3M_24240         CDS       T02316                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Brite
Enzymes [BR:esm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     O3M_24240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF4600
Motif
Other DBs
NCBI-ProteinID: AFS59492
LinkDB All DBs
Structure
PDB: 

Position
complement(5028827..5029447)
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagctataccctgccatccctgccgtatgcttacgatgccctggaaccgcacttcgat
aagcagaccatggaaatccaccacaccaaacaccatcagacctacgtaaacaacgccaac
gcggcgctggaaagcctgccagaatttgccaacctgccggttgaagagctgatcaccaaa
ctggaccagctgccagcagacaagaaaaccgtactgcgcaacaacgctggcggtcacgct
aaccacagcctgttctggaaaggtctgaaaaaaggcaccaccctgcagggtgacctgaaa
gcggctatcgaacgtgacttcggctccgttgataacttcaaagcagaatttgaaaaagcg
gcagcttcccgctttggttccggctgggcatggctggtgctgaaaggcgataaactggcg
gtggtttctactgctaaccaggattctccgctgatgggtgaagctatttctggcgcttcc
ggcttcccgattctgggcctggatgtgtgggaacatgcttactacctgaaattccagaac
cgccgtccggactacattaaagagttctggaacgtggtgaactgggacgaagcagcggca
cgttttgcggcgaaaaaataa

DBGET integrated database retrieval system