KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_00125Help
Entry
O3O_00125         CDS       T02256                                 

Gene name
pstB
Definition
(GenBank) phosphate transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eso00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    O3O_00125 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eso02000]
    O3O_00125 (pstB)
Enzymes [BR:eso01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     O3O_00125 (pstB)
Transporters [BR:eso02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    O3O_00125 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_22 AAA_29 RsgA_GTPase AAA_16 AAA_23 Rad17 PRK AAA_30 AAA_33 AAA_24 PhoH G-alpha AAA_25 RNA_helicase Adeno_IVa2 ATPase_2 AAA_18 AAA_5 TniB AAA_28 APS_kinase
Motif
Other DBs
NCBI-ProteinID: AFS83818
LinkDB All DBs
Position
5287954..5288727
Genome map
AA seq 257 aa AA seqDB search
MSMVETAPSKIQVRNLNFYYGKFHALKNINLDIAKNQVTAFIGPSGCGKSTLLRTFNKMF
ELYPEQRAEGEILLDGDNILTNSQDIALLRAKVGMVFQKPTPFPMSIYDNIAFGVRLFEK
LSRADMDERVQWALTKAALWNETKDKLHQSGYSLSGGQQQRLCIARGIAIRPEVLLLDEP
CSALDPISTGRIEELITELKQDYTVVIVTHNMQQAARCSDHTAFMYLGELIEFSNTDDLF
TKPAKKQTEDYITGRYG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggttgaaactgccccgagtaaaattcaggttcgtaatttgaacttctactac
ggcaaattccatgccctgaaaaacatcaacctggatatcgctaaaaaccaggtaacggcg
tttatcgggccgtccggctgcggtaaatcgacgctgctgcgtaccttcaacaaaatgttt
gaactgtatccggagcagcgtgcggaaggtgaaattctgcttgatggcgacaacatcctg
accaactctcaggatatcgccctgctgcgtgcgaaagtgggcatggtgttccagaaaccg
acgccgtttccgatgtccatctacgacaacatcgcttttggcgttcgtctgtttgagaag
ctctcccgtgccgacatggacgagcgcgtgcagtgggcattgaccaaagccgcattgtgg
aacgaaaccaaagataaattgcaccagagcggttactctctctctggtggtcagcaacag
cgtctgtgtattgcgcgtggtatcgccattcgcccggaagtgctgctgctcgacgaaccg
tgttcggcgctcgaccctatctctaccgggcgtattgaagagctgatcaccgaactgaag
caggattacaccgtggtgatcgtcacccacaacatgcagcaggctgcgcgttgttccgac
cacacggcgtttatgtacctgggcgaattgattgagttcagcaacacggacgatctgttc
accaagccagcgaagaaacaaacagaagactacatcaccggtcgttacggttga

DBGET integrated database retrieval system