KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_05755Help
Entry
O3O_05755         CDS       T02256                                 

Definition
(GenBank) fructokinase
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso00051  Fructose and mannose metabolism
eso00500  Starch and sucrose metabolism
eso00520  Amino sugar and nucleotide sugar metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    O3O_05755
   00500 Starch and sucrose metabolism
    O3O_05755
   00520 Amino sugar and nucleotide sugar metabolism
    O3O_05755
Enzymes [BR:eso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     O3O_05755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG Hydant_A_N Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AFS84923
LinkDB All DBs
Position
complement(4056901..4057809)
Genome map
AA seq 302 aa AA seqDB search
MRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIATLVYMAEQATGQRGTV
GMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDGAAA
GAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELRYREEVPCYCGK
QGCIETFISGTGFATDYRRLSGHALKGSEIISLVEESDPVAELALRRYELRLAKSLAHVV
NILDPDVIVLGGGMSNVDRLYQTVGQLIKQFVFGGECETPVRKAKHGDSSGVRGAAWLWP
QE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtataggtatcgatttaggcggcaccaaaactgaagtgattgcactgggcgatgca
ggggagcagttgtaccgccatcgtctgcccacgccgcgtgatgattaccggcagactatt
gaaacgatcgccacgttggtttatatggcggagcaggcgacagggcagcgcggaacggta
ggtatgggcattcctggctcaatttcgccctacaccggcgtggtgaaaaatgccaattca
acctggctcaacggtcagccattcgataaagacttaagcgcgcggttgcagcgggaagtg
cggctggcaaatgacgccaactgtctggccgtttcagaagcagtagatggcgcggcagcg
ggagcacagacggtatttgccgtgattatcggcacgggatgcggcgcgggcgtggcattc
aatgggcgggcgcatatcggcggcaatggcacggcaggcgagtggggacacaatccgcta
ccttggatggacgaagacgaactgcgttatcgcgaggaagtcccttgttattgcggtaaa
caaggttgtattgaaacctttatttcgggcacgggatttgccacagattatcgtcgtttg
agcggacatgcgctgaaaggcagtgaaattatcagcctggttgaagaaagcgatccggta
gcggaactggcattgcgtcgctacgagctgcggctggcaaaatcgctggcacatgtcgtg
aatattctcgatccggatgtaattgtcctggggggcgggatgagcaatgtagaccgttta
tatcaaacggttgggcagttgattaaacaatttgtcttcggcggcgaatgtgaaacgccg
gtgcgtaaggcgaagcacggtgattccagcggcgtacgcggcgctgcgtggttatggcca
caagagtaa

KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_18075Help
Entry
O3O_18075         CDS       T02256                                 

Definition
(GenBank) aminoimidazole riboside kinase
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso00051  Fructose and mannose metabolism
eso00500  Starch and sucrose metabolism
eso00520  Amino sugar and nucleotide sugar metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    O3O_18075
   00500 Starch and sucrose metabolism
    O3O_18075
   00520 Amino sugar and nucleotide sugar metabolism
    O3O_18075
Enzymes [BR:eso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     O3O_18075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AFS87348
LinkDB All DBs
Position
1569121..1570035
Genome map
AA seq 304 aa AA seqDB search
MSAKVWVLGDAVVDLLPESDGRLLPCPGGAPANVAVGIARLGGTSGFIGRVGDDPFGALM
QRTLLTEGVDITYLKQDEWHRTSTVLVDLNDQGERSFTFMVRPSADLFLETTDLPCWRHG
EWLHLCSIALSAEPSRTSAFTAMTAIRHAGGFVSFDPNIREDLWQDEHLLRLCLRQALQL
ADVVKLSEEEWRLISGKTQNDRDICALAKEYEIAMLLVTKGAEGVVVCYRGQVHHFAGMS
VNCVDSTGAGDAFVAGLLTGLSSTGLSTDEREMRRIIDLAQRCGALAVTAKGAMTALPCR
QELE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccaaagtatgggttttaggggatgcggtcgtagatctcttgccagaatcagac
gggcgcctactgccttgtcctggcggcgcgccagctaacgttgcggtgggaatcgccaga
ttaggcggaacaagtgggtttataggtcgggtgggggatgatccttttggtgcgttaatg
caaagaacgctgctaactgagggagtcgatatcacgtatctgaagcaagatgaatggcac
cggacatccacggtgcttgtcgatctgaacgatcaaggggaacgttcatttacgtttatg
gtccgccccagtgccgatctttttttagagacgacagacttgccctgctggcgacatggc
gaatggttacatctctgttcaattgcgttgtctgccgagccttcgcgtaccagcgcattt
actgcgatgacggcgatccggcatgccggaggttttgtcagcttcgatcctaatattcgt
gaagatctatggcaagacgagcatttgctccgcttgtgtttgcggcaggcgctacaactg
gcggatgtcgtcaagctctcggaagaagaatggcgacttatcagtggaaaaacacagaac
gatcgggatatatgcgccctggcaaaagagtatgagatcgccatgctgttggtgactaaa
ggtgcagaaggtgtggtggtctgttatcgaggacaagttcaccattttgctggaatgtct
gtgaattgtgtcgatagcacgggggcgggagatgcgttcgttgccgggttactcacaggt
ctgtcctctacgggattatctacagatgagagagaaatgcgacgaattatcgatctcgct
caacgttgcggagcgcttgcagtaacggcgaaaggggcaatgacagcgctgccatgtcga
caagaactggaatag

DBGET integrated database retrieval system