KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_05795Help
Entry
O3O_05795         CDS       T02256                                 

Definition
(GenBank) maltodextrin glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso00052  Galactose metabolism
eso00500  Starch and sucrose metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    O3O_05795
   00500 Starch and sucrose metabolism
    O3O_05795
Enzymes [BR:eso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     O3O_05795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_N DUF3459 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AFS84931
LinkDB All DBs
Structure
PDB: 

Position
complement(4043726..4045543)
Genome map
AA seq 605 aa AA seqDB search
MMLNAWHLPVPPFVKQSKDQLLITLWLTGEDPPQRIMLRTEHDNEEMSVSMHKQRSQQQP
GVTAWRAAIDLSSGQPRRRYSFKLLWHDRQRWFTPQGFSRMPPARLEQFAVDVPDIGPQW
AADQIFYQIFPDRFARSLPREAEQDHVYYHHAAGQEIILRDWDEPVTAQAGGSTFYGGDL
DGISEKLPYLKKLGVTALYLNPVFKAPSVHKYDTEDYRHVDPQFGGDGALLRLRHNTQQL
GMRLVLDGVFNHSGDSHAWFDRHNRGTGGACHNPESPWRDWYSFSDDGTALDWLGYASLP
KLDYQSESLVNEIYRGEDSIVRHWLKAPWSMDGWRLDVVHMLGEAGGARNNMQHVAGITE
AAKETQPEAYIVGEHFGDARQWLQADVEDAAMNYRGFTFPLWGFLANTDISYDPQQIDAQ
TCMAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLGRDIARLPLAVVWLFTWPGVPCI
YYGDEVGLDGKNDPFCRKPFPWQVEKQDTALFALYQRMIALRKKSQALRHGGCQVLYAED
NVVVFVRVLNQQRVLVAINRGEACEVVLPASPLLNAVQWQCKEGHGQLTDGILALPAISA
TVWMN
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgatgttaaatgcatggcacctgccggtgcccccatttgttaaacaaagcaaagatcaa
ctgctcattacactgtggctgacgggcgaagacccaccgcagcgcattatgctgcgtaca
gaacacgataacgaagaaatgtcagtatcgatgcataagcagcgcagtcagcagcagcct
ggcgtcaccgcatggcgtgcggcgattgatctctccagcggacaaccccggcggcgttac
agtttcaaactgctgtggcacgatcgccagcgttggtttacaccgcagggcttcagccga
atgccgccggcacgactggagcagtttgccgtcgatgtaccggatatcggcccacaatgg
gctgcggatcagattttttatcagatcttccctgatcgttttgcgcgtagtcttcctcgt
gaagctgaacaggatcatgtctattaccatcatgcagccggacaagagatcatcttgcgt
gactgggatgaaccggtcacggcgcaggcgggcggatcaacgttctatggcggcgatctg
gacgggataagcgaaaaactgccgtatctgaaaaagcttggcgtgacggcgctgtatctc
aatccggtgtttaaagctcccagcgtacataaatacgataccgaggattatcgccatgtc
gatccgcagtttggcggtgatggggcgttgctgcgtttgcgacacaatacgcagcagctg
ggaatgcggctggtgctggacggcgtgtttaaccacagtggcgattcccatgcctggttt
gacaggcacaatcgtggcacggggggagcttgtcacaaccctgaatcgccctggcgcgac
tggtactcgtttagtgatgatggcacggcgctcgactggcttggctatgccagcttgccg
aagctggattatcagtcggaaagtctggtgaatgaaatttatcgcggggaagacagtatt
gtccgccattggctgaaagcgccgtggagtatggacggctggcggctggatgtggtgcat
atgctgggggaggcgggtggggcacgcaataatatgcagcacgttgctgggatcaccgaa
gcggcgaaagaaacccagccggaagcgtatattgtcggcgaacattttggcgatgcacgg
caatggttacaggccgatgtggaagatgccgccatgaactatcgtggcttcacattcccg
ttgtggggatttcttgccaataccgatatctcttacgatccgcagcaaattgatgcccaa
acctgtatggcctggatggataattaccgcgcagggctttctcatcaacaacaattacgt
atgtttaatcagctcgacagccacgatactgcgcgatttaaaacgctgctcggtcgggat
attgcgcgcctgccgctggcggtggtctggctgttcacctggcctggtgtaccgtgcatt
tattacggtgatgaagtaggactggatggcaaaaacgatccgttttgccgtaaaccgttc
ccttggcaggtggaaaagcaagatacggcgttattcgcgctgtaccagcgaatgattgcg
ctgcgtaagaaaagtcaggcgctacgtcatggcggctgtcaggtgctgtatgcggaagat
aacgtggtggtatttgtccgcgtgctgaatcagcagcgtgtactggtggcaatcaaccgt
ggcgaagcttgtgaagtcgtgctacccgcgtcaccgttgctcaatgccgtgcaatggcaa
tgcaaagaagggcatgggcaactgactgacgggattctggctttgcctgccatttcggct
acggtatggatgaactaa

DBGET integrated database retrieval system