KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_07040Help
Entry
O3O_07040         CDS       T02256                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso00520  Amino sugar and nucleotide sugar metabolism
eso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    O3O_07040 (nagA)
Enzymes [BR:eso01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     O3O_07040 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AFS85175
LinkDB All DBs
Structure
PDB: 

Position
3772429..3773577
Genome map
AA seq 382 aa AA seqDB search
MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQL
NGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVGVMREYLAK
HPNQALGLHLEGPWLNLVKKGTHNPNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEV
ISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEAD
IYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCV
DENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANL
TAFTPDFKITKTIVNGNEVVTQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcattaacccagggccggatctttaccggccacgaatttcttgatgaccacgcg
gttgttatcgctgatggcctgattaaaagcgtctgtccggtagcggaactgccgccagag
atcgaacaacgttcactgaacggggccattctctcccccggttttatcgatgtgcagtta
aacggctgcggcggcgtacagtttaacgacaccgctgaagcggtcagcgtggaaacgctg
gaaatcatgcagaaagccaatgagaaatcaggctgtactaactatctgccgacgcttatc
accaccagcgatgagctgatgaaacagggcgtaggcgttatgcgcgagtacctggcaaaa
catccgaatcaggcgttaggtctgcatctggaaggtccgtggctgaatctggtaaaaaaa
ggcacccataatccgaattttgtgcgtaagcctgatgccgcgctggtcgatttcctgtgt
gaaaacgccgacgtcattaccaaagtgaccctggcaccggaaatggttcctgcggaagtc
atcagcaaactggcaaatgccgggattgtggtttctgccggtcactccaacgcgacgttg
aaagaagcaaaagccggtttccgcgcggggattacctttgccacccatctgtacaacgcg
atgccgtatattaccggtcgtgaaccgggcctggcgggcgcgatcctcgacgaagctgac
atttattgcggtattattgctgatggcctgcatgttgattacgccaacattcgtaacgct
aaacgtctgaaaggcgacaaactgtgtctggttaccgacgccaccgcgccagcaggtgcc
aacattgaacagttcatttttgcgggtaaaacaatatactaccgtaacggactttgtgtg
gatgagaacggtacgttaagcggttcatccttaaccatgattgaaggcgtgcgtaatctg
gtcgaacattgcggtatcgcactggatgaagtgctgcgtatggcgacgctctatccggcg
cgtgcgattggcgttgagaaacgtctcggcacactcgccgcaggtaaagtagccaacctg
accgcattcacacctgattttaaaatcaccaagaccatcgttaacggtaacgaggtcgta
actcaataa

DBGET integrated database retrieval system