KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_09170
Entry
O3O_09170         CDS       T02256                                 

Definition
(GenBank) Shiga toxin 2 subunit B
  KO
K11007  shiga toxin subunit B
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso02024  Quorum sensing
Module
eso_M00363  EHEC pathogenicity signature, Shiga toxin
Brite
KEGG Orthology (KO) [BR:eso00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    O3O_09170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:eso02042]
    O3O_09170
Bacterial toxins [BR:eso02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    O3O_09170
SSDB
Motif
Pfam: SLT_beta Peptidase_C28 DUF2541 Porin_7 PCC_BT
Other DBs
NCBI-ProteinID: AFS85601
LinkDB
Structure
PDB: 
4M1U 1R4P 3MXG

Position
complement(3341835..3342104)
AA seq 89 aa
MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagcttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg
aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system