KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_10335Help
Entry
O3O_10335         CDS       T02256                                 

Definition
(GenBank) N-acetyl-D-glucosamine kinase
  KO
K00884  N-acetylglucosamine kinase [EC:2.7.1.59]
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso00520  Amino sugar and nucleotide sugar metabolism
eso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    O3O_10335
Enzymes [BR:eso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.59  N-acetylglucosamine kinase
     O3O_10335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFS85829
LinkDB All DBs
Position
complement(3105732..3106643)
Genome map
AA seq 303 aa AA seqDB search
MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRFGCKGSV
GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
QYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGCG
QHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNI
LTIVDPDLVVIGGGLSNFPAITTQLADRLPRHLLPVARVPRIERARHGDAGGMRGAAFLH
LTD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtattacgggtttgatattggtggaacaaaaattgcgcttggcgtgtttgatagcggt
cggcagttgcagtgggaaaagcgggtgccgacaccgcgtgacagctatgacgcattttta
gatgcagtgtgtgagctggtagctgaagctgaccaacgttttggctgtaaaggttctgtc
ggcatcggtattccgggaatgccggaaacagaagatggtacgctgtatgccgccaatgtc
cccgctgccagcggtaaaccgctgcgtgccgacctgagcgcacgtcttgatcgcgatgta
cgccttgataacgatgccaactgttttgccctttcagaagcctgggatgatgaatttact
caatatccactggtgatggggttgattctcggcaccggcgttggcggcgggctgattttc
aacggcaaaccgattaccggtaaaagctacattaccggcgagtttggccatatgcgtctg
ccggttgatgcgttaaccatgatggggttggatttcccgttacgccgctgcggctgtggt
cagcatggctgcattgaaaattatctgtctggtcgcggttttgcgtggctgtatcaacac
tattatcatcaaccgttgcaggctcccgaaattattgcgctttatgatcaaggcgatgag
caggcaagggcgcacgttgagcgttatctggatttattagcggtttgtctgggaaatatc
ctgaccattgttgaccctgacctggtcgtcattggtggtggcttatcgaatttcccggca
atcacaacgcaactggcggacaggctgcctcgtcatctcttacctgtagctcgtgttccg
cgcattgaacgcgcgcgccacggtgatgcgggaggaatgcgtggtgcggccttcctacat
ctaaccgattaa

DBGET integrated database retrieval system