KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_10945Help
Entry
O3O_10945         CDS       T02256                                 

Gene name
treA
Definition
(GenBank) trehalase
  KO
K01194  alpha,alpha-trehalase [EC:3.2.1.28]
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso00500  Starch and sucrose metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    O3O_10945 (treA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eso00537]
    O3O_10945 (treA)
Enzymes [BR:eso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.28  alpha,alpha-trehalase
     O3O_10945 (treA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eso00537]
 Enzymes
  O3O_10945 (treA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trehalase GDE_C Glyco_hydro_63
Motif
Other DBs
NCBI-ProteinID: AFS85948
LinkDB All DBs
Structure
PDB: 

Position
3004347..3006044
Genome map
AA seq 565 aa AA seqDB search
MKSPAPSRPQKMALIPACIFLCFAALSVQAEETPVTPQPPDILLGPLFNDVQNAKLFPDQ
KTFADAVPNSDPLMILADYRMQQNQSGFDLRHFVNVNFTLPKEGEKYVPPEGQSLREHID
GLWPVLTRSTENTEKWDSLLPLPEPYVVPGGRFREVYYWDSYFTMLGLAESGHWDKVADM
VANFAHEIDTYGHIPNGNRSYYLSRSQPPFFALMVELLAQHEGDAALKQYLPQMQKEYAY
WMDGVENLQAGQQEKRVVKLQDGTLLNRYWDDRDTPRPESWVEDIATAKSNPNRPATEIY
RDLRSAAASGWDFSSRWMDNPQQLNTLRTTSIVPVDLNSLMFKMEKILARASKAAGDNAM
ANQYETLANARQKGIEKYLWNDQQGWYADYDLKSHKVRNQLTAAALFPLYVNAAAKDRAN
KMATATKTHLLQPGGLNTTSVKSGQQWDAPNGWAPLQWVATEGLQNYGQKEVAMDISWHF
LTNVQHTYDREKKLVEKYDVSTTGTGGGGGEYPLQDGFGWTNGVTLKMLDLICPKEQPCD
NVPATRPTVKSATTQPSTKEAQPTP
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcccccgcaccttctcgcccgcaaaaaatggcgttaattccagcctgtatcttt
ttgtgtttcgctgcgctatcggtgcaggcagaagaaacaccggtaacaccacagccgcct
gatattttattagggccgctgtttaatgatgtgcaaaacgccaaactttttccggaccaa
aaaacctttgccgatgccgtgccgaacagcgatccgctgatgatccttgctgattatcgg
atgcagcaaaaccagagcggatttgatctgcgccatttcgttaacgtcaatttcaccctg
ccgaaagaaggcgagaaatatgttccgccagaggggcagtcactgcgcgaacatattgac
ggactttggccggtattaacgcgttctaccgaaaacaccgaaaaatgggattctctgtta
ccgctgccggaaccttatgtcgtgccgggcggacgttttcgcgaggtatattactgggac
agttacttcaccatgttaggacttgccgaaagcggtcactgggataaagtcgcggatatg
gtggccaattttgctcatgaaatagacacttacggtcatattcccaacggcaaccgcagt
tactatttaagccgctcgcaaccgcccttctttgccctgatggtagagttactggcgcag
catgaaggcgatgccgcgttgaagcaatacctgccgcaaatgcaaaaagaatatgcttac
tggatggacggtgttgaaaacctgcaagccggacaacaggaaaaacgcgttgtcaaactt
caggatggtacccttctcaaccgctactgggacgatcgcgatacgccacgaccagagtca
tgggtggaagatattgccaccgccaaaagcaatccgaatcgacctgccactgaaatttac
cgcgacctgcgctctgccgctgcgtctggctgggatttcagctcgcgctggatggacaac
ccgcagcagttaaataccttacgcaccaccagcatcgtaccggtcgatctgaacagcctg
atgtttaaaatggaaaaaatcctcgcccgcgccagcaaagctgccggagataacgcgatg
gcaaaccagtacgaaacgctggcaaatgcccgtcaaaaagggatcgaaaaatacctgtgg
aacgatcaacaaggctggtatgccgattacgacctgaaaagtcataaagtgcgcaatcag
ttaaccgcggccgccctgttcccgctgtacgtcaatgcggcagcgaaagatcgcgccaac
aaaatggcgacggcgacgaaaacacatctgctgcaacccggcggcctgaacaccacgtcg
gtgaaaagtgggcaacaatgggatgcgccaaatggctgggcaccgttacagtgggtcgcg
acagaaggattacaaaactacgggcaaaaagaggtggcgatggacattagctggcacttc
ctgaccaatgttcagcacacctatgaccgggagaaaaagctggtggaaaaatatgatgtc
agcaccaccggaacggggggcggcggtggcgaatatccattacaggatggctttggctgg
accaatggcgtgacgctgaaaatgctggatttgatctgcccgaaagagcaaccgtgtgac
aatgttccggcgacgcgtccgaccgttaagtcagcaacgacgcaaccctcaaccaaagag
gcacaacccacaccttaa

KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_24370Help
Entry
O3O_24370         CDS       T02256                                 

Gene name
treF
Definition
(GenBank) trehalase
  KO
K01194  alpha,alpha-trehalase [EC:3.2.1.28]
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso00500  Starch and sucrose metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    O3O_24370 (treF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eso00537]
    O3O_24370 (treF)
Enzymes [BR:eso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.28  alpha,alpha-trehalase
     O3O_24370 (treF)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eso00537]
 Enzymes
  O3O_24370 (treF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trehalase Bac_rhamnosid6H DUF346 Glyco_hydro_63
Motif
Other DBs
NCBI-ProteinID: AFS88587
LinkDB All DBs
Position
complement(257584..259233)
Genome map
AA seq 549 aa AA seqDB search
MLNQKIQNPNPDELMIEVDLCYELDPYELKLDEMIEAEPEPEMIEGLPASDALTPADRYL
ELFEHVQSAKIFPDSKTFPDCAPKMDPLDILIRYRKVRRHRDFDLRKFVENHFWLPEVYS
REYVSDPQNSLKEHIDQLWPVLTREPQDHIPWSSLLALPQSYIVPGGRFSETYYWDSYFT
MLGLAESGREDLLKCMADNFAWMIENYGHIPNGNRTYYLSRSQPPVFALMVELFEEDGVR
GARRYLDHLKMEYAFWMDGAESLIPNQAYRHVVRMPDGSLLNRYWDDRDTPRDESWLEDV
ETAKHSGRPPNEVYRDLRAGAASGWDYSSRWLRDTGRLASIRTTQFIPIDLNAFLFKLES
AIANISALKGEKETEALFRQKASARRDAVNRYLWDDENGIYRDYDWRREQLALFSAAAIV
PLYVGMANHEQADRLANAVRSRLLTPGGILASEYETGEQWDKPNGWAPLQWMAIQGFKMY
GDDLLGDEIARSWLKTVNQFYLEQHKMIEKYHIADGVPREGGGGEYPLQDGFGWTNGVVR
RLIGLYGEP
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatcagaaaattcaaaaccctaatccagacgaactgatgatcgaagtcgatctc
tgctatgagctggacccgtatgaattaaaactggatgagatgatcgaggcagaaccggaa
cccgagatgattgaagggctgcccgcctctgatgcgctgacgcctgccgatcgctatctc
gaactgttcgagcatgttcagtcggcgaaaattttccccgacagtaaaacctttcccgac
tgcgcacccaaaatggacccgctggatattttaatccgctaccgtaaagtgcgccgtcat
cgtgattttgacttgcgcaagtttgttgaaaatcacttctggctgccggaggtctactcc
agagagtatgtatcggacccgcaaaattccctgaaagagcatatcgaccagctgtggccg
gtgctaacccgcgaaccacaggatcacattccgtggtcttctctgctggcgctaccgcag
tcatatattgtcccgggcggccgttttagcgaaacctactattgggattcctatttcacc
atgctggggctggcggaaagtggtcgggaagatttgctgaaatgcatggccgataacttc
gcctggatgatcgaaaactatggtcacatccccaacggcaaccgcacctattatttgagc
cgatcgcaaccaccggtttttgcgctgatggtggagttgtttgaagaagatggtgtacgc
ggtgcgcgccgctatctcgaccaccttaaaatggaatatgccttctggatggacggtgca
gaatcgttgatccctaatcaggcctatcgccatgttgtgcggatgccggacggatcgctg
ctcaaccgttattgggacgatcgcgacacgccgcgtgacgaatcctggcttgaggacgtt
gaaaccgcgaaacattctggtcgcccgcccaacgaggtgtaccgcgatttacgcgcggga
gcggcctcaggttgggattactcttcccgttggctgcgtgatactggtcgtctggcgagc
attcgtaccacccagttcatccccatcgatctgaatgccttcctgtttaaactggagagc
gccatcgccaacatctcggcgctgaaaggcgagaaagagacagaagcgctgttccgccag
aaggccagtgcccgtcgcgatgcggtaaaccgttacctctgggatgatgaaaacggcatc
taccgcgattacgactggcgacgcgaacaactggcgctgttttccgctgccgccattgtg
ccgctctatgtcggcatggcgaaccatgaacaggccgatcgtctggcaaacgccgtacgc
agccggttactgacacctggcgggattctggcaagcgagtacgaaaccggtgaacagtgg
gataaacccaatggctgggcaccgttacaatggatggcaattcagggatttaaaatgtat
ggcgatgaccttctgggtgatgaaatcgcgcgcagctggctgaaaacggtgaatcagttc
tatctggaacagcacaaaatgatcgagaaataccatattgccgatggtgttccccgcgaa
ggcggcggtggcgagtatccgttgcaggatgggtttggctggactaacggtgtggtacgc
cgtttaattggtttgtacggcgaaccataa

DBGET integrated database retrieval system