KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_12860Help
Entry
O3O_12860         CDS       T02256                                 

Definition
(GenBank) putative transporter
Organism
eso  Escherichia coli O104:H4 2009EL-2071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2 DUF2937
Motif
Other DBs
NCBI-ProteinID: AFS86324
LinkDB All DBs
Position
complement(2602971..2604158)
Genome map
AA seq 395 aa AA seqDB search
MNLSLRRSTSALLASSLLLTIGRGATLPFMTIYLSRQYSLSVDLIGYAMTIALTIGVVFS
LGFGILADKFDKKRYMLLAITAFASGFIAIPLVNNVTLVVLFFALINCAYSVFATVLKAW
FADNLSSTSKTKIFSINYTMLNIGWTIGPPLGTLLVMQSINLPFWLAAICSAFPMLFIQI
WVKRSEKIIATETGSVWSPKVLLQDKALLWFTCSGFLASFVSGAFASCISQYVMVIADGD
FAEKVVAVVLPVNAAMVVTLQYSVGRRLNPANIRALMTAGTLCFVIGLVGFIFSGNSLLL
WGMSAAVFTVGEIIYAPGEYMLIDHIAPPGMKASYFSAQSLGWLGAAINPLVSGVVLTSL
PPSSLFVILALVIIAAWVLMLKGIRARPWGQPALC
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaacttatccctacgacgctctaccagcgcccttcttgcctcgtcgttgttattaacc
atcggacgcggcgctacgctgccatttatgaccatttacttgagtcgccagtacagcctg
agtgtcgatctaatcggttatgcgatgacaattgcgctcactattggcgtcgtttttagc
ctcggttttggtatcctggcggataagttcgacaagaaacgctatatgttactggcaatt
accgccttcgccagcggttttattgccattcctttagtgaataacgtaacgctggtggtg
ctcttttttgccctcattaactgcgcctattctgtttttgctaccgtgctgaaagcctgg
tttgccgacaatctttcgtccaccagcaaaacgaaaatcttctcaatcaactacaccatg
ctaaacattggctggaccatcggtccgccgctcggcacgctgttggtgatgcagagcatc
aatctgcccttctggctggcagctatctgttccgcgtttcccatgcttttcattcaaatt
tgggtaaagcgcagcgagaaaatcatcgccacggaaacaggcagtgtctggtcgccgaaa
gttttattacaagataaagcactgttgtggtttacctgctctggttttctggcttctttt
gtaagcggcgcatttgcttcatgcatttcacaatatgtgatggtgattgctgatggggat
tttgccgaaaaggtggtcgcggttgttcttccggtgaatgctgccatggtggttacgttg
caatattccgtgggccgccgacttaacccggctaacatccgcgcgctgatgacagcaggc
accctatgtttcgtcatcggtctggtcggttttattttttccggcaacagcctgctattg
tggggtatgtcagctgcggtatttactgtcggtgaaatcatttatgcgccgggcgagtat
atgttgattgaccatattgcgccgccaggaatgaaagccagctatttttccgcccagtct
ttaggctggcttggtgccgcgattaacccattagtgagtggcgtagtgctaaccagcctg
ccgccttcctcgctgtttgtcatcttagcgttggtgatcattgctgcgtgggtgctgatg
ttaaaagggattcgtgcaagaccgtgggggcagcccgcgctttgttga

DBGET integrated database retrieval system