KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_14760Help
Entry
O3O_14760         CDS       T02256                                 

Definition
(GenBank) PTS system mannose-specific transporter subunits IIAB
  KO
K02794  mannose PTS system EIIAB component [EC:2.7.1.191]
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso00051  Fructose and mannose metabolism
eso00520  Amino sugar and nucleotide sugar metabolism
eso01100  Metabolic pathways
eso02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    O3O_14760
   00520 Amino sugar and nucleotide sugar metabolism
    O3O_14760
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    O3O_14760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eso02000]
    O3O_14760
Enzymes [BR:eso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.191  protein-Npi-phosphohistidine---D-mannose phosphotransferase
     O3O_14760
Transporters [BR:eso02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component
    O3O_14760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb EIIA-man
Motif
Other DBs
NCBI-ProteinID: AFS86699
LinkDB All DBs
Structure
PDB: 

Position
complement(2243704..2244675)
Genome map
AA seq 323 aa AA seqDB search
MTIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTK
GVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVE
TGREGVKALKAKPVEKAAPAPAAAAPKAAPTPAKPMGPNDYMVIGLARIDDRLIHGQVAT
RWTKETNVSRIIVVSDEVAADTVRKTLLTQVAPPGVTAHVVDVAKMIRVYNNPKYAGERV
MLLFTNPTDVERLVEGGVKITSVNVGGMAFRQGKTQVNNAVSVDEKDIEAFKKLNARGIE
LEVRKVSTDPKLKMMDLISKIDK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgaccattgctattgttataggcacacatggttgggctgcagagcagttgcttaaaacg
gcagaaatgctgttaggcgagcaggaaaacgtcggctggatcgatttcgttccaggtgaa
aatgccgaaacgctgattgaaaagtacaacgctcagttggcaaaactcgacaccactaaa
ggcgtgctgtttctcgttgatacatggggaggcagcccgttcaatgctgccagccgcatt
gtcgtcgacaaagagcattatgaagtcattgcaggcgttaacattccaatgctcgtggaa
acgttaatggcccgtgatgatgacccaagctttgatgaactggtggcactggcagtagaa
acaggccgtgaaggcgtgaaagctctgaaagccaaaccggttgaaaaagccgcgccagca
cccgctgccgcagcaccaaaagcggctccaactccggcaaaaccaatggggccaaacgac
tacatggttattggccttgcgcgtatcgacgaccgtctgattcacggtcaggtcgccacc
cgctggaccaaagaaaccaatgtctcccgtattattgttgttagtgatgaagtggctgcg
gataccgttcgtaagacactgctcacccaggttgcacctccgggcgtaacagcacacgta
gttgatgttgccaaaatgattcgcgtctacaacaacccgaaatatgctggcgaacgcgta
atgctgttatttaccaacccaacagatgtagagcgtctcgttgaaggcggcgtgaaaatc
acctctgttaacgtcggtggtatggcattccgtcagggtaaaacccaggtgaataacgcg
gtttcggttgatgaaaaagatatcgaggcgttcaagaaactgaatgcgcgcggtattgag
ctggaagtccgtaaggtttccaccgatccgaaactgaaaatgatggatctgatcagcaaa
atcgataagtaa

KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_14765Help
Entry
O3O_14765         CDS       T02256                                 

Definition
(GenBank) PTS system mannose-specific transporter subunit IIC
  KO
K02795  mannose PTS system EIIC component
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso00051  Fructose and mannose metabolism
eso00520  Amino sugar and nucleotide sugar metabolism
eso01100  Metabolic pathways
eso02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    O3O_14765
   00520 Amino sugar and nucleotide sugar metabolism
    O3O_14765
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    O3O_14765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eso02000]
    O3O_14765
Transporters [BR:eso02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component
    O3O_14765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EII-Sor
Motif
Other DBs
NCBI-ProteinID: AFS86700
LinkDB All DBs
Structure
PDB: 

Position
complement(2242841..2243641)
Genome map
AA seq 266 aa AA seqDB search
MEITTLQIVLVFIVACIAGMGSILDEFQFHRPLIACTLVGIVLGDMKTGIIIGGTLEMIA
LGWMNIGAAVAPDAALASIISTILVIAGHQSIGAGIALAIPLAAAGQVLTIIVRTITVAF
QHAADKAADNGNLTAISWIHVSSLFLQAMRVAIPAVIVALSVGTSEVQNMLNAIPEVVTN
GLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNFNLVALGVIGTVMAVLYIQ
LSPKYNRVAGAPAQAAGNNDLDNELD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggagattaccactcttcaaattgtgctggtatttatcgtagcctgtatcgcaggtatg
ggatcaatcctcgatgaatttcagtttcaccgtccgctaatcgcgtgtaccctggtgggt
atcgttcttggggatatgaaaaccggtattattatcggtggtacgctggaaatgatcgcg
ctgggctggatgaacatcggtgctgcagttgcgcctgacgccgctctggcttctatcatt
tctaccattctggttatcgcaggtcatcagagcattggtgcaggtatcgcactggcaatc
cctctggccgctgcgggccaggtactgaccatcatcgttcgtactattaccgttgctttc
cagcacgctgcggataaggctgctgataacggcaacctgacagcgatttcctggatccac
gtttcttctctgttcctgcaagcaatgcgtgtggctattccggccgtcatcgttgcgctg
tctgttggtaccagcgaagtacagaacatgctgaatgcgattccggaagtggtgaccaat
ggtctgaatatcgccggtggcatgatcgtggtggttggttatgcgatggttatcaacatg
atgcgtgctggctacctgatgccgttcttctacctcggcttcgtaaccgcagcattcacc
aactttaacctggttgctctgggtgtgattggtactgttatggcagtgctctacatccaa
cttagcccgaaatacaaccgcgtagccggtgcgcctgctcaggcagctggtaacaacgat
ctcgataacgaactggactaa

KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_14770Help
Entry
O3O_14770         CDS       T02256                                 

Definition
(GenBank) PTS system mannose-specific transporter subunit IID
  KO
K02796  mannose PTS system EIID component
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso00051  Fructose and mannose metabolism
eso00520  Amino sugar and nucleotide sugar metabolism
eso01100  Metabolic pathways
eso02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    O3O_14770
   00520 Amino sugar and nucleotide sugar metabolism
    O3O_14770
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    O3O_14770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eso02000]
    O3O_14770
Transporters [BR:eso02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component
    O3O_14770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIID-AGA
Motif
Other DBs
NCBI-ProteinID: AFS86701
LinkDB All DBs
Structure
PDB: 

Position
complement(2241977..2242837)
Genome map
AA seq 286 aa AA seqDB search
MSEMVDTTQTTTEKKLTQSDIRGVFLRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPEN
NEARKQAIRRHLEFFNTQPFVAAPILGVTLALEEQRANGAEIDDGAINGIKVGLMGPLAG
VGDPIFWGTVRPVFAALGAGIAMSGSLLGPLLFFILFNLVRLATRYYGVAYGYSKGIDIV
KDMGGGFLQKLTEGASILGLFVMGALVNKWTHVNIPLVVSRITDQTGKEHVTTVQTILDQ
LMPGLVPLLLTFACMWLLRKKVNPLWIIVGFFVIGIAGYACGLLGL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaatggttgatacaactcaaactaccaccgagaaaaaactcactcaaagtgat
attcgtggcgtcttcctgcgttctaacctcttccagggttcatggaacttcgaacgtatg
caggcactgggtttctgcttctctatggtaccggcaattcgtcgcctctaccctgagaac
aacgaagctcgtaaacaagctattcgccgtcacctggagttctttaacacccagccgttc
gtggctgcgccgattctcggcgtaaccctggcgctggaagaacagcgtgctaatggcgca
gagatcgacgacggtgctatcaacggtatcaaagtcggtttgatggggccgctggctggt
gtaggcgacccgatcttctggggaaccgtacgtccggtatttgcagcactgggtgccggt
atcgcgatgagcggcagcctgttaggtccgctgctgttcttcatcctgtttaacctggtg
cgtctggcaacccgttactacggcgtagcgtatggttactccaaaggtatcgatatcgtt
aaagatatgggtggtggcttcctgcaaaaactgacggaaggggcgtctatcctcggcctg
tttgtcatgggggcattggttaacaagtggacacatgtcaacatcccgctggttgtctct
cgcattactgaccagacgggcaaagaacacgttactactgtccagactattctggaccag
ttaatgccaggcctggtaccactgctgctgacctttgcttgtatgtggctactgcgcaaa
aaagttaacccgctgtggatcatcgttggcttcttcgtcatcggtatcgctggttacgct
tgcggcctgctgggactgtaa

DBGET integrated database retrieval system