KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_16345Help
Entry
O3O_16345         CDS       T02256                                 

Definition
(GenBank) UDP-glucose 6-dehydrogenase
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso00040  Pentose and glucuronate interconversions
eso00053  Ascorbate and aldarate metabolism
eso00520  Amino sugar and nucleotide sugar metabolism
eso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    O3O_16345
   00053 Ascorbate and aldarate metabolism
    O3O_16345
   00520 Amino sugar and nucleotide sugar metabolism
    O3O_16345
Enzymes [BR:eso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     O3O_16345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh UDPG_MGDP_dh_C F420_oxidored Glyco_hydro_4 ApbA Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AFS87008
LinkDB All DBs
Position
1950612..1951778
Genome map
AA seq 388 aa AA seqDB search
MKITISGTGYVGLSNGLLIAQNHEVVALDILPSRVAMLNDRISPIVDKEIQQFLQSDKIH
FNATLDKNEAYRDADYVIIATPTDYDPKTNYFNTSSVESVIKDVVEINPYAVMIIKSTVP
VGFTAAMHKKYRTENIIFSPEFLREGKALYDNLHPSRIVIGERSERAERFAALLQEGAIK
QNIPTLFTDSTEAEAIKLFANTYLAMRVAYFNELDSYAESLGLNSRQIIEGVCLDPRIGN
HYNNPSFGYGGYCLPKDTKQLLANYQSVPNNLISAIVDANRTRKDFIADAILSRKPQVVG
IYRLIMKSGSDNFRASSIQGIMKRIKAKGVEVIIYEPVMKEDSFFNSRLERDLATFKQQA
DVIISNRMAEELKDVADKVYTRDLFGSD
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaccatttccggtactggctatgtaggcttgtcaaacggacttctaatcgca
caaaatcatgaggttgtggcattagatattttaccgtcacgcgttgctatgctgaatgat
cggatatctcctatagttgataaggaaattcagcagtttttgcaatcagataaaatacac
tttaatgccacattagataaaaatgaagcctaccgggatgctgattatgtcattatcgcc
actccaaccgactatgatcctaaaactaattatttcaatacatcgagtgtagaatcagta
attaaagacgtagtagagataaatccttatgcggttatgatcatcaaatcaacggtaccc
gttggctttaccgcagcgatgcataagaaatatcgtactgaaaatattattttctctccg
gaatttctccgtgagggtaaagccctttacgataatctccatccttcacgtattgtcatc
ggtgagcgttcagaacgcgcagaacgtttcgctgcgttattacaggaaggagcgattaag
caaaatatcccgaccctgtttaccgactccactgaagcagaagcgattaaactttttgca
aacacctacctggcgatgcgcgtggcgtactttaacgaactggatagctacgcagaaagt
ttaggtctgaattcccgtcaaataatcgaaggcgtttgtctcgacccacgaattggcaac
cattacaacaatccgtcgtttggttatggtggttattgtctgccgaaagataccaagcag
ttactggcgaactaccagtctgtgccgaataacctgatctcggcaattgtcgatgcaaac
cgcacgcgtaaagattttattgccgatgccattttgtcacgcaaaccgcaagtggtgggt
atttatcgtctgattatgaagagcgggtcagataacttccgtgcgtcttccattcagggg
attatgaaacgtatcaaggcgaaaggcgttgaagtgatcatctacgaaccagtgatgaaa
gaagactcattcttcaactctcgcctggaacgtgatctcgccaccttcaaacaacaagcc
gacgtcattatttccaaccgtatggcagaagagcttaaggatgtggcagacaaagtctac
acccgcgatctctttggcagtgactaa

DBGET integrated database retrieval system