KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_16850Help
Entry
O3O_16850         CDS       T02256                                 

Definition
(GenBank) beta-D-glucoside glucohydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso00460  Cyanoamino acid metabolism
eso00500  Starch and sucrose metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    O3O_16850
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    O3O_16850
Enzymes [BR:eso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     O3O_16850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like CARDB DUF4842 PHP
Motif
Other DBs
NCBI-ProteinID: AFS87106
LinkDB All DBs
Position
1828650..1830947
Genome map
AA seq 765 aa AA seqDB search
MKWLCSVGIAVSLALQPALADDLFGNHPLTPEARDAFVTELLKKMTVDEKIGQLRLISVG
PDNPKEAIREMIKDGQVGAIFNTVTRQDIRAMQDQVMELSRLKIPLFFAYDVLHGQRTVF
PISLGLASSFNLDAVKTVGRVSAYEAADDGLNMTWAPMVDVSRDPRWGRASEGFGEDTYL
TSTMGKTMVEAMQGKSPADRYSVMTSVKHFAAYGAVEGGKEYNTVDMSPQRLFNDYMPPY
KAGLDAGSGAVMVALNSLNGTPATSDSWLLKDVLRDQWGFKGITVSDHGAIKELIKHGTA
ADPEDAVRVALKSGINMSMSDEYYSKYLPGLIKSGKVTMEELDDAARHVLNVKYDMGLFN
DPYSHLGPKESDPVDTNAESRLHRKEAREVARESLVLLKNRLETLPLKKSATIAVVGPLA
DSKRDVMGSWSAAGVADQSVTVLTGIKNSVGENGKVLYAKGANVTSDKGIIDFLNQYEEA
VKVDPRSPQEMIDEAVQTAKQSDVVVAVVGEAQGMAHEASSRTDITIPQSQRDLIAALKA
TGKPLVLVLMNGRPLALVKEDQQADAILETWFAGTEGGNAIADVLFGDYNPSGKLPMSFP
RSVGQIPVYYSHLNTGRPYNADKPNKYTSRYFDEANGALYPFGYGLSYTTFTVSDVKLSA
PTMKRDGKVTASVQVTNTGKREGATVVQMYLQDVTASMSRPVKQLKGFEKITLKPGETQT
VSFPIDIEALKFWNQQMKYDAEPGKFNVFIGTDSARVKKGEFELL
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggctatgttcagtaggaatcgcggtgagtctggccctgcagccagcactggcg
gatgatttattcggcaaccatccattaacgcccgaagcgcgggatgcgttcgtcaccgaa
ctgcttaagaaaatgacagttgatgagaaaattggtcagctgcgcttaatcagcgtcggc
ccggataacccgaaagaggcgatccgcgagatgatcaaagacggtcaggttggggcgatt
ttcaacaccgtaacccgtcaggatatccgcgccatgcaggatcaggtgatggaattaagc
cgcctgaaaattcctcttttctttgcttacgacgtgctgcacggtcagcgcacggtgttc
ccgattagcctcggtctggcctcgtcttttaacctcgatgcagtgaaaacggtcggacgt
gtctctgcttatgaagcggcagatgatggcctgaatatgacctgggcaccgatggtcgat
gtctcgcgcgatccgcgctggggacgtgcttccgaaggttttggcgaagatacgtatctc
acctcaacaatgggtaaaaccatggtggaagcgatgcagggtaaaagcccggcagatcgc
tactcggtgatgaccagcgtcaaacactttgccgcatacggcgcggtagaaggcggtaaa
gagtacaacaccgtcgatatgagtccgcagcgcctgtttaatgattatatgccgccgtac
aaagcggggctggacgcaggcagcggcgcggtgatggtggcgctgaactcgctgaacggc
acgccagccacctccgattcctggctgctgaaagatgttctgcgcgaccagtggggcttt
aaaggcatcaccgtttccgatcacggtgcaatcaaagagctgattaaacatggcacggcg
gcagacccggaagatgcggtgcgcgtggcgctgaaatccggaatcaacatgagtatgagc
gacgagtattactcgaagtatctgcctgggttgatcaaatccggcaaagtgacgatggaa
gagctggacgatgctgcccgccatgtactgaacgttaaatatgatatgggattgtttaac
gacccatacagccatttggggccgaaagagtctgacccggttgacactaatgccgaaagc
cgcctgcaccgtaaagaagcgcgtgaagtggcgcgcgaaagcctggtgttgctgaaaaac
cgtctcgaaacgttaccgctgaaaaaatcggccaccattgcggtggttgggccactggcg
gacagtaaacgtgacgtgatgggcagctggtccgcagccggtgttgccgatcaatccgtg
accgtactgactgggattaaaaattccgtcggtgaaaacggtaaagtgctgtatgccaaa
ggggcgaacgttaccagtgacaaaggcattatcgatttcctgaatcagtatgaagaagcg
gtcaaagtcgatccgcgttcgccgcaagagatgattgatgaagcggtgcagacggcgaaa
caatctgatgtggtggtggctgtagtcggtgaagcacaggggatggcgcacgaagcctcc
agccggaccgatatcactattccgcaaagccaacgtgacttgattgcggcgctgaaagcc
accggtaaaccgctggtgctggtgctgatgaacgggcgtccgctggcgctggtgaaagaa
gatcagcaggctgatgcgattctggaaacctggtttgcggggactgaaggcggtaatgca
attgccgatgtattgtttggcgattacaacccgtccggcaagctgccaatgtccttcccg
cgttctgtcgggcagatcccggtgtactacagccatctgaataccggtcgcccgtataat
gccgacaagccgaacaaatacacttcgcgttattttgatgaagctaacggggcgttgtat
ccgttcggctatgggctgagctacaccactttcaccgtctctgatgtgaaactttctgcg
ccgaccatgaagcgtgacggcaaagtgactgccagcgtgcaggtgacgaacaccggtaag
cgcgagggggccacggtagtgcagatgtacttgcaggatgtgacggcttccatgagtcgc
cctgtgaaacagctgaaaggctttgagaaaatcaccctgaaaccgggcgaaactcagact
gtcagcttcccgatcgatattgaggcgctgaagttctggaatcaacagatgaaatatgac
gccgagcctggcaagttcaatgtatttatcggcactgattccgcacgcgttaagaaaggc
gagtttgagttgctgtaa

DBGET integrated database retrieval system