KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_18105Help
Entry
O3O_18105         CDS       T02256                                 

Definition
(GenBank) EmrKY-TolC multidrug resistance efflux pump, membrane fusion protein component
  KO
K07797  multidrug resistance protein K
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eso00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3O_18105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD HlyD_3 HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl Membrane_bind ORMDL YpmT PepSY_TM
Motif
Other DBs
NCBI-ProteinID: AFS87354
LinkDB All DBs
Position
1561865..1563028
Genome map
AA seq 387 aa AA seqDB search
MEQINSNKKHSNRRKYFSLLAVVLFIAFSGAYAYWSMELEDMISTDDAYVTGNADPISAQ
VSGSVTVVNHKDTNYVRQGDILVSLDKTDATIALNKAKNNLANIVRQTNKLYLQDKQYSA
EVASARIQYQQSLEDYNRRVPLAKQGVISKETLEHTKDTLISSKAALNAAIQAYKANKAL
VMNTPLNRQPQVVEAADATKEAWLALKRTDIKSPVTGYIAQRSVQVGETVSPGQSLMAVV
PARQMWVNANFKETQLTDVRIGQSVNIISDLYGENVVFHGRVTGINMGTGNAFSLLPAQN
ATGNWIKIVQRVPVEVSLDPKELMEHPLRIGLSMTATIDTKNEDIAEMPELASTVTSMPA
YTSKALVIDTSPIEKEISNIISHNGQL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtggaacagattaattcaaataaaaaacattctaacagaagaaaatacttttctttattg
gcggtagttttatttattgcgttttcaggtgcctatgcctattggtcaatggaattagaa
gacatgattagtacagatgacgcctatgtcacggggaatgcagatccaatttctgcacaa
gtctcaggtagtgtcactgtcgttaatcataaagatacgaactacgttcgacaaggtgac
attttagtttcactggataaaactgatgccactatcgcactcaataaagctaaaaataat
ctggcaaatattgttcggcaaacgaataaactatacttacaggataaacaatacagtgcc
gaagtcgcttcagcacgtattcagtatcaacaatctttagaagattataaccgtcgagtg
ccgttagcgaagcagggggttatttcaaaagaaacgctggagcataccaaagatacgtta
ataagtagcaaagcggcattgaatgccgctatccaggcttataaagcgaataaagcttta
gtaatgaacacaccattaaaccgtcagccacaagtcgttgaagcggcggatgcaactaaa
gaagcctggttggcgcttaaacgtacggatattaagagtccggttaccggctatattgcc
cagcgaagtgttcaggtcggcgaaacagtgagccccggacaatcgttaatggctgtcgta
ccggcacgtcaaatgtgggttaatgccaactttaaagaaacacaacttacggatgtacgg
attggtcaatcggtcaatattatcagcgatctttatggtgaaaatgttgtgtttcatggt
cgggtgacagggatcaatatgggaaccggcaatgcgttctccttattacctgcacaaaat
gcgacagggaactggatcaaaatcgttcagcgtgtaccggttgaagtttctcttgatcca
aaagaactcatggaacatcccttgcgtattggtttatcgatgacagcaactattgatacg
aagaacgaagacattgccgagatgcctgagctggcttcaaccgtgacctccatgccggct
tataccagtaaggctttagttatcgataccagtccgatagaaaaagaaattagcaacatt
atttcgcataatggacaactttaa

DBGET integrated database retrieval system