KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_23585Help
Entry
O3O_23585         CDS       T02256                                 

Gene name
hslO
Definition
(GenBank) Hsp33-like chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Brite
KEGG Orthology (KO) [BR:eso00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:eso03110]
    O3O_23585 (hslO)
Chaperones and folding catalysts [BR:eso03110]
 Heat shock proteins
  HSP33
   O3O_23585 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AFS88432
LinkDB All DBs
Structure
PDB: 

Position
complement(431317..432195)
Genome map
AA seq 292 aa AA seqDB search
MPQHDQLHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLK
FDGDITVQLQGDGPMNLAVINGNNNQQMRGVARVQGEIPENADLKTLVGNGYVVITITPS
EGERYQGVVGLEGDTLAACLEDYFMRSEQLPTRLFIRTGDVDGKPAAGGMLLQVMPAQNA
QQDDFDHLATLTETIKTEELLTLPANEVLWRLYHEEEVTVYDPQDVEFKCTCSRERCADA
LKTLPDEEVDSILAEDGEIDMHCDYCGNHYLFNAMDIAEIRNNASPADPQVH
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaacatgaccaattacatcgctatctgtttgaaaactttgccgtgcgcggcgaa
ctggtaaccgtttcggaaaccctgcaacagatccttgagaatcacgattatccgcagccc
gttaaaaacgtgctggcagaactgctggttgcgaccagcctgttaaccgctacgctgaag
tttgatggtgatatcaccgtacagctgcaaggcgacggtccgatgaatctggcggttatt
aacggtaacaataaccagcaaatgcgcggtgtggcgcgcgtgcagggcgaaattccagaa
aatgccgacctgaaaacgctggtcggcaatggttacgtggtgatcaccattaccccgagc
gaaggcgaacgctatcagggcgtggttggtctggaaggtgataccctggcggcctgcctg
gaagattactttatgcgttctgaacagctgccgacgcgcctgtttattcgcaccggcgac
gtagacggcaaaccggctgcaggcggtatgttgttgcaggtaatgcctgcgcaaaatgcc
cagcaggacgactttgaccacctggcgacgctaaccgaaaccatcaaaaccgaagaactg
ctgaccttaccggcaaacgaagtgttgtggcgtttgtatcacgaagaagaggtgacggtt
tacgatccgcaggatgtggagttcaaatgcacctgctcgcgtgaacgttgcgccgacgcg
ctgaaaacgctgcctgatgaagaagtcgatagcatcctggcggaagatggcgaaattgac
atgcattgtgattactgcggtaaccactatctgttcaatgcgatggatattgctgaaatc
cgcaacaacgcgtctccggcagatccgcaagttcattaa

DBGET integrated database retrieval system