KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_23750Help
Entry
O3O_23750         CDS       T02256                                 

Gene name
glgC
Definition
(GenBank) glucose-1-phosphate adenylyltransferase
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso00500  Starch and sucrose metabolism
eso00520  Amino sugar and nucleotide sugar metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso02026  Biofilm formation - Escherichia coli
Module
eso_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    O3O_23750 (glgC)
   00520 Amino sugar and nucleotide sugar metabolism
    O3O_23750 (glgC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    O3O_23750 (glgC)
Enzymes [BR:eso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     O3O_23750 (glgC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Fucokinase
Motif
Other DBs
NCBI-ProteinID: AFS88465
LinkDB All DBs
Structure
PDB: 

Position
388736..390031
Genome map
AA seq 431 aa AA seqDB search
MVSLEKNDHLMLARQLPLKSVALILAGGRGTRLKDLTNKRAKPAVHFGGKFRIIDFALSN
CINSGIRRMGVITQYQSHTLVQHIQRGWSFFNEEMNEFVDLLPAQQRMKGENWYRGTADA
VTQNLDIIRRYKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVPIEEASAFGV
MAVDENDKIIEFVEKPANPPSMPNDPSKSLASMGIYVFDADYLYELLEEDDRDENSSHDF
GKDLIPKITEAGLAYAHPFPLSCVQSDPDAEPYWRDVGTLEAYWKANLDLASVVPELDMY
DRNWPIRTYNESLPPAKFVQDRSGSHGMTLNSLVSGGCVISGSVVVQSVLFSRVRVNSFC
NIDSAVLLPEVWVGRSCRLRRCVIDRACVIPEGMVIGENAEEDARRFYRSEEGIVLVTRE
MLRKLGHKQER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggttagtttagagaagaacgatcacttaatgttggcgcgccagctgccattgaaatct
gttgccctgatactggcgggaggacgtggtacccgcctgaaggatttaaccaataagcga
gcaaaaccggccgtacacttcggcggtaagttccgcattatcgactttgcgctgtctaac
tgcatcaactccgggatccgtcgtatgggcgtgatcacccagtaccagtcccacactctg
gtgcagcacattcagcgcggctggtcattcttcaatgaagaaatgaacgagtttgtcgat
ctgctgccagcacagcagagaatgaaaggggaaaactggtatcgcggcaccgcagatgcg
gtcacccaaaacctcgatattatccgccgttataaagcggaatacgtggtgatcctggcg
ggcgaccatatctacaagcaagactactcgcgtatgcttatcgatcacgtcgaaaaaggc
gcacgttgcaccgttgcttgtatgccagtaccgattgaagaagcctccgcatttggcgtt
atggcggttgatgagaacgataaaattatcgaattcgttgaaaaacctgctaacccaccg
tcaatgccgaacgatccgagcaaatctctggcgagtatgggtatctacgtctttgacgcc
gactatctgtatgaactgctggaagaagacgatcgtgatgagaactccagccacgacttt
ggcaaagatttgattcccaagatcaccgaagccggtctggcctatgcgcacccgttcccg
ctctcttgcgtacaatccgacccggatgccgagccgtactggcgcgatgtgggtacgctg
gaagcttactggaaagcgaacctcgatctggcctctgtggtgccggaactggatatgtac
gatcgcaattggccaattcgcacctacaatgaatcattaccgccagcgaaattcgtgcag
gatcgctccggtagccacgggatgacccttaactcactggtatccggcggttgtgtgatc
tccggttcggtggtggtgcagtccgttctgttctcgcgcgttcgcgtgaattcattctgc
aacattgattccgccgtattgttaccggaagtatgggtaggtcgctcgtgccgtctgcgc
cgctgcgtcatcgatcgtgcttgtgttattccggaaggcatggtgattggtgaaaacgca
gaggaagatgcacgtcgtttctatcgttcagaagaaggcatcgtgctggtaacgcgcgaa
atgctacggaagttagggcataaacaggagcgataa

DBGET integrated database retrieval system