KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_24440Help
Entry
O3O_24440         CDS       T02256                                 

Gene name
bcsA
Definition
(GenBank) cellulose synthase catalytic subunit
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Pathway
eso00500  Starch and sucrose metabolism
eso01100  Metabolic pathways
eso02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    O3O_24440 (bcsA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    O3O_24440 (bcsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:eso01003]
    O3O_24440 (bcsA)
Enzymes [BR:eso01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     O3O_24440 (bcsA)
Glycosyltransferases [BR:eso01003]
 Polysaccharide
  Structural polysaccharide
   O3O_24440 (bcsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_trans_2_3 Cellulose_synt Glyco_transf_21 PilZ
Motif
Other DBs
NCBI-ProteinID: AFS88601
LinkDB All DBs
Position
233537..236155
Genome map
AA seq 872 aa AA seqDB search
MSILTRWLLIPPVNARLIGRYRDYRRHGASAFSATLGCFWMILAWIFIPLEHPRWQRIRA
EHKNLYPHINASRPRPLDPVRYLIQTCWLLIGTSRKETPKPRRRAFSGLQNIRGRYHQWM
NELPERVSHKTQHLDEKKELGHLSAGARRLILGIIVTFSLILALICVTQPFNPLAQFIFL
MLLWGVALIVRRMPGRFSALMLIVLSLTVSCRYIWWRYTSTLNWDDPVSLVCGLILLFAE
TYAWIVLVLGYFQVVWPLNRQPVPLPKDMSLWPSVDIFVPTYNEDLNVVKNTIYASLGID
WPKDKLNIWILDDGGREEFRQFAQNVGVKYIARTTHEHAKAGNINNALKYAKGEFVSIFD
CDHVPTRSFLQMTMGWFLKEKQLAMMQTPHHFFSPDPFERNLGRFRKTPNEGTLFYGLVQ
DGNDMWDATFFCGSCAVIRRKPLDEIGGIAVETVTEDAHTSLRLHRRGYTSAYMRIPQAA
GLATESLSAHIGQRIRWARGMVQIFRLDNPLTGKGLKFAQRLCYVNAMFHFLSGIPRLIF
LTAPLAFLLLHAYIIYAPALMIALFVLPHMIHASLTNSKIQGKYRHSFWSEIYETVLAWY
IAPPTLVALINPHKGKFNVTAKGGLVEEEYVDWVISRPYIFLVLLNLVGVAVGIWRYFYG
PPTEMLTVVVSMVWVFYNLIVLGGAVAVSVESKQVRRSHRVEMTMPAAIAREDGHLFSCT
VQDFSDGGLGIKINGQAQILEGQKVNLLLKRGQQEYVFPTQVARVMGNEVGLKLMPLTTQ
QHIDFVQCTFARADTWALWQDSYPEDKPLESLLDILKLGFRGYRHLAEFAPSSVKGIFRV
LTSLVSWVVSFIPRRPERSETAQPSDQALAQQ
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcctgacccggtggttgcttatcccgccggtcaacgcgcggcttatcgggcgt
tatcgcgattatcgtcgtcacggtgcgtcggctttcagcgcgacgctcggctgtttctgg
atgatcctggcctggatttttattccgctggagcacccgcgctggcagcgtattcgcgca
gaacataaaaacctgtatccgcatatcaacgcctcgcgtccgcgtccgctggacccggtc
cgttatctcattcaaacatgctggttactgatcggtacatcgcgcaaagaaacgccgaaa
ccgcgcaggcgggcattttcaggtctgcagaatattcgtggacgttaccatcaatggatg
aacgagctgcctgagcgcgttagccataaaacacagcatcttgatgagaaaaaagagctc
ggtcatttgagtgccggggcgcggcggttgatcctcggtatcatcgtcaccttctcgctg
attctggcgttaatctgcgttactcaaccgtttaacccgctggcgcagtttatcttcctg
atgctgctgtggggtgtagcgctgatcgtacggcggatgccggggcgcttctcggcgcta
atgttgattgtgctgtcgctgaccgtttcttgccgttatatctggtggcgttacacctct
acgctgaactgggacgatccggtcagcctggtgtgcgggcttattctgctcttcgctgaa
acgtacgcgtggattgtgctggtgctcggctacttccaggtagtatggccgctgaatcgt
cagccggtgccattgccgaaagatatgtcgctgtggccgtcggtggatatctttgtcccg
acttacaacgaagatctcaacgtggtgaaaaatactatttacgcctcgctgggtatcgac
tggccgaaagacaagctgaacatctggatcctcgatgacggcggtagggaagagtttcgc
cagtttgcgcaaaacgtgggggtgaaatatatcgcccgtaccactcatgaacatgcgaaa
gcgggcaacatcaacaatgcgctgaaatatgccaaaggcgagttcgtgtcgattttcgac
tgcgaccacgtaccaacgcgatcgttcctgcaaatgaccatgggctggttcctgaaagag
aaacagctggcgatgatgcagactccacaccacttcttctcgccagacccgtttgaacgc
aacctggggcgttttcgtaaaacaccgaacgaaggcacgctgttctatggtctggtgcag
gatggcaacgatatgtgggacgccactttcttctgcggttcctgtgcggtgattcgccgt
aagccgctggatgaaattggcggcattgctgtcgaaactgtgactgaagatgcgcatact
tctctgcgtttgcaccgtcgtggatatacctccgcgtatatgcgtattccgcaggcggcg
gggctggcgaccgaaagtctgtcggcgcatatcggtcagcgtattcgctgggcgcgcggg
atggtgcaaatcttccgtctcgataacccgctcaccggtaaagggctgaaattcgctcag
cggctgtgctacgtcaacgccatgttccacttcttgtcgggcattccacggctgatcttc
ctgactgcgccgctggcgttcctgctgcttcatgcctacatcatctatgcgccagcgttg
atgatcgccctattcgtgctgccgcatatgatccatgccagcctgaccaactcgaagatc
cagggcaaatatcgccactctttctggagtgaaatctacgaaacggtgctggcgtggtat
atcgcaccaccgacgctggtggcgctgattaacccgcacaaaggcaaatttaacgtcacc
gccaaaggtggactggtggaagaagagtacgtcgactgggtgatctcgcggccctacatc
ttccttgttctactcaacctggtgggcgttgcggtaggcatctggcgctacttctatggc
ccgccaaccgagatgctcaccgtggtcgtcagtatggtgtgggtgttctacaacctgatt
gttcttggcggcgcagttgcggtatcggtagaaagcaaacaggtacgccgatcgcaccgc
gtggagatgacgatgcccgcggcaattgcccgcgaagatggtcacctcttctcgtgtacc
gttcaggatttctccgacggtggtttggggatcaagatcaacggtcaggcgcagattctg
gaagggcagaaagtgaatctgttgcttaaacgcggtcagcaggaatacgtcttcccgacc
caggtggcgcgcgtgatgggtaatgaagttgggctgaaattaatgccgctcaccacccag
caacatatcgattttgtgcagtgtacgtttgcccgtgcggatacatgggcgctctggcag
gacagctacccggaagataagccgctggaaagtctgctggatattctgaagctcggcttc
cgtggctaccgccatctggcggagtttgcgccttcttcggtgaagggcatattccgtgtg
ctgacttctctggtttcctgggttgtatcgtttattccgcgccgcccggagcggagcgaa
acggcacaaccatcggatcaggctttggctcaacaatga

DBGET integrated database retrieval system