KEGG   Eubacterium siraeum V10Sc8a: ES1_06850Help
Entry
ES1_06850         CDS       T02589                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
esr  Eubacterium siraeum V10Sc8a
Pathway
esr00970  Aminoacyl-tRNA biosynthesis
esr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ES1_06850
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:esr03029]
    ES1_06850
Enzymes [BR:esr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ES1_06850
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ES1_06850
Mitochondrial biogenesis [BR:esr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ES1_06850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CBL33790
UniProt: D4MJ57
LinkDB All DBs
Position
747901..749349
Genome map
AA seq 482 aa AA seqDB search
MELKKQTLGSLREMLDTKQISAAELCKEYSDSIKAKDSDVLGYITVTEDEALKNAEKAQE
IIDKGEAKALTGIPLAIKDNICTDGIRTTCASKMLENFVPPYDANVIEKLKAENYVLLGK
TSMDEFAMGGSTQTSAFAKTRNPFDLSRVPGGSSGGSAAVVSAGLAPAALGSDTGGSIRQ
PASFCGVTGLKPTYGRVSRYGLVAFASSLDQIGPIANSAVDCGTILNVICGKDSRDATSA
NKPAEDFNAKVGKDIKGMKIALPKEFFADSTDDEVKNAVLAAAKKYEEMGATLVDCSMKS
LKYAVSAYYLVASAEAASNLSRFDGIKYGLRGEGRTFDEMIRDSRTRGFGDEVKRRILLG
NYALSSGYYDAYYLKALALKQQIIKEYNEIFENADVILTPTAPTVAYKIGEQETDPVKMY
LADICTVTVNIASLPAISVPCGYNADGMPIGMSLVGRKWDEATLIQTADAFEKTFERRYS
EV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggagcttaaaaaacagacactgggttctctgcgtgaaatgctcgacacaaagcagata
agcgccgcagagctttgcaaggaatattcagacagcataaaggctaaagattccgatgta
ctcggatatatcacagtgaccgaagacgaggcactgaaaaatgcggaaaaggcgcaggag
attatagacaagggcgaggcaaaggcactcaccggtatacctcttgcaataaaggataac
atctgcacggacgggataagaacgacctgtgcatcaaagatgctcgaaaactttgttccg
ccttatgatgcaaacgtaatagaaaagctgaaggccgagaattatgtgcttctcggaaaa
acaagtatggacgaatttgcaatgggtggctctacacagacaagcgcattcgcaaagaca
agaaacccctttgacttatcccgtgtacccggcggttcaagcggcggctctgcggctgta
gtatctgcaggacttgcacctgcggcactcggaagcgacacgggcggctctataagacag
cctgcttcattctgcggcgttacaggccttaagccaacctacggcagagtatcacgctac
ggtctggtggcattcgcaagctcgcttgaccagataggccctatcgcaaacagtgcggtt
gactgcggtactatactgaacgttatctgcggcaaggacagccgtgatgcaacaagcgca
aacaagcccgccgaggacttcaacgccaaggtcggcaaggatataaagggaatgaagata
gcactccccaaagaattcttcgcagacagcacagatgacgaagtgaagaatgcggttctt
gcggcggctaagaaatacgaagaaatgggcgcaacgctcgttgactgctcgatgaagagc
cttaagtacgcagtatcggcttactaccttgtggcaagtgccgaggcggcatccaacctt
tcacgctttgacggcatcaagtatggacttcggggcgagggcagaacctttgacgaaatg
attcgtgacagccgtacaagaggcttcggtgatgaggtaaagcgccgtatacttctcggt
aactacgcactttcaagcggttactatgacgcatactatttaaaggcgctggcattaaaa
cagcagattataaaggaatataacgagatattcgagaatgcggacgttattctgacacct
accgctcctactgtagcatataagataggtgagcaggaaaccgaccctgtaaagatgtat
cttgcagatatatgtaccgtaacggtaaacatcgcatcgctcccggcaatctccgtaccc
tgcggatataacgcagacggtatgcccataggaatgtcgcttgtcggcagaaagtgggac
gaggctacgctgatacagacggcagacgcttttgaaaagacgtttgaaagacgttacagc
gaggtttaa

DBGET integrated database retrieval system