KEGG   Eubacterium siraeum V10Sc8a: ES1_16070Help
Entry
ES1_16070         CDS       T02589                                 

Definition
(GenBank) Glycosidases
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
esr  Eubacterium siraeum V10Sc8a
Pathway
esr00500  Starch and sucrose metabolism
esr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ES1_16070
Enzymes [BR:esr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ES1_16070
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     ES1_16070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Cyc-maltodext_C DUF3459 hDGE_amylase Glyco_hydro_30C
Motif
Other DBs
NCBI-ProteinID: CBL34553
UniProt: D4MLC0
LinkDB All DBs
Position
complement(1744730..1746268)
Genome map
AA seq 512 aa AA seqDB search
MAKWLENAIFYEIYPQSFNDTNGDGIGDFQGIIEKLDYIKETGFNAIWMNPCFDSPFGDA
GYDVRDYKKAAARYGTNDDLKRLFDECHKRGMHILLDLVPGHTSVEHEWFKKSMLPESNE
YTDRYIWTSNIWEQPEGLNCIRGISDRDGSAAVNFFSSQPALNYGYAEPKYAYQQKPTDP
GPMATRAAIKDVMKFWLDMGCDGFRVDMAGSLVKCDPEYKETIKLWQDITGYLKSEYPEA
AMVSEWGEPQYSLQGGFDMDFLLHFGPEGYNSMFRSAEPFFSKRGKGTPAIFAEQYNGYH
EKATTGGGLICIPSGNHDMDRLARGRDEDELKCCFAFLLTMPGAPFVYYGDEIGMNFVEG
LVSVEGGYNRTGSRSPMQWDSTANDGFSTADKSQLYIKQDDAPDRPTVEKQMLDEKSLYN
EIKKLIKLRNENSALHNLSAFEFVSSDGYPLVYKRSSDNQTVYVFINPSDKAVTVNADYA
KGGKAIYTLGENGSVKANTVTVPASGAIFVEV
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtggttggaaaatgcaattttttacgagatatacccgcaatccttcaatgat
acaaatggtgacggtatcggagattttcagggtataatcgaaaagctggactatatcaag
gaaacaggcttcaacgcaatatggatgaatccctgctttgattcgcccttcggtgatgcg
ggctatgatgtaagggactataaaaaagccgccgcaagatacggaacaaacgatgattta
aagcgacttttcgatgagtgccataagcgtgggatgcacattcttcttgaccttgtaccc
ggtcacacttcggtagagcatgaatggttcaaaaagtcgatgctccccgaaagcaacgag
tataccgacagatatatctggacaagcaatatatgggaacaaccggaaggccttaactgt
ataagaggcatatctgaccgtgacggcagtgccgcagtcaacttcttctcatctcagcct
gcgctgaactacggctatgccgagcctaagtatgcttatcagcaaaagcctacagatccc
ggacctatggcgacaagagccgcaatcaaggatgttatgaagttctggcttgatatgggc
tgtgacggtttcagagtggatatggcaggctctcttgtaaaatgcgatcccgaatataaa
gaaacaatcaagctatggcaggatataacgggttatcttaagagcgaatatcccgaagcc
gctatggtatcggagtggggcgagccgcaatattcgctgcagggcggctttgatatggac
ttcttactgcacttcggtcctgagggctacaactcgatgttcagaagtgccgaaccgttc
ttttcaaagaggggcaaaggtactcccgcaatctttgccgagcagtacaacggctatcac
gaaaaggcaacgacaggcggcggacttatctgcattccgtcaggcaatcacgatatggac
agacttgcaagaggcagggatgaagacgagcttaaatgctgttttgctttccttctcaca
atgcccggcgcaccgtttgtatactacggcgatgagatcggaatgaactttgtagaaggt
cttgtatcggtagagggcggctataaccgtaccggatcaagaagtcctatgcagtgggac
agcaccgcaaatgacggattttcaactgcggacaagtcacagctttatataaagcaggat
gacgcacccgacagacctactgtcgaaaagcagatgctcgatgaaaagtcgctctacaac
gaaataaagaaactgataaagctaagaaacgaaaattccgcacttcacaatctctcagcc
tttgagtttgtcagcagtgacggttatccgctggtatacaagagaagcagcgataatcag
acggtttatgtgttcatcaatccgtccgataaggccgtaactgtcaatgcagattatgca
aagggcggaaaggcaatttacacgctcggcgaaaacggctctgttaaagcaaatacagtt
accgttcccgcaagcggtgcaatttttgttgaggtataa

DBGET integrated database retrieval system