KEGG   Eubacterium siraeum V10Sc8a: ES1_16950Help
Entry
ES1_16950         CDS       T02589                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
esr  Eubacterium siraeum V10Sc8a
Brite
KEGG Orthology (KO) [BR:esr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:esr03012]
    ES1_16950
   03029 Mitochondrial biogenesis [BR:esr03029]
    ES1_16950
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:esr04147]
    ES1_16950
Translation factors [BR:esr03012]
 Eukaryotic Type
  Elongation factors
   ES1_16950
 Prokaryotic Type
   ES1_16950
Mitochondrial biogenesis [BR:esr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ES1_16950
Exosome [BR:esr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ES1_16950
  Exosomal proteins of breast cancer cells
   ES1_16950
  Exosomal proteins of colorectal cancer cells
   ES1_16950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: CBL34627
UniProt: D4MLJ4
LinkDB All DBs
Position
1842912..1844114
Genome map
AA seq 400 aa AA seqDB search
MAKQKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLSLKGYAQFEAYDMIDKAPEERERG
ITINTAHVEYETDKRHYAHVDCPGHADYIKNMITGAAQMDGAILVVAGTDGPMAQTKEHI
LLAHQVGVPAIVVFINKCDDVDDPELLDLVEMDIRETLSEHDFPGDDVPVIRGSAKVALD
CPSKDINAPEYACIIELMNAVDDYIPTPDRKADLPFLMPVEDTMTISGRGTVATGRVERG
ILKLNDTVEITGLTDEPKQTVVTGIEMFRKLLDFAEAGDNIGTLLRGIQRNEIERGQVLC
KPGSIHPHKKFKGQVYVLKKEEGGRHTPFFSNYRPQFFFRTTDVTGVITLPADKEMCMPG
DNVTMDVELITPIAIEEGLRFAIREGGRTVGSGVVTAINE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcagaaatttgaacgtaccaagccccacgtaaacattggtacaatcggtcac
gtagaccacggtaagactactttaacagcagctatcactaaggttctttcactcaagggc
tatgctcagttcgaagcatacgatatgatcgacaaggctcccgaggagagagagcgtggt
atcacaatcaacacagctcacgttgagtatgagacagacaagcgtcactacgcacacgtt
gactgccccggccacgctgactatatcaagaacatgatcacaggtgctgctcagatggac
ggcgctatcctcgttgttgccggtacagacggtcctatggctcagactaaggagcacatc
cttctcgctcaccaggtaggcgttcccgcaatcgttgtattcatcaacaagtgcgatgac
gttgacgatcccgagcttctcgacctcgttgagatggatatccgtgagacactttcagag
catgacttccccggcgatgacgttcccgttatccgtggttcagctaaggttgctcttgat
tgccccagcaaggacatcaacgctcccgaatatgcttgcatcatagagcttatgaatgca
gttgacgattacattcctactcctgatcgtaaggctgatctccccttccttatgcctgtt
gaggatactatgacaatttccggtcgtggtacagttgctacaggtagagttgagagaggt
atcctcaagctcaacgatacagttgaaatcactggtcttacagacgagcctaagcagaca
gttgtaacaggtatcgaaatgttccgtaagctcctcgacttcgctgaagcaggtgacaac
atcggtacacttctccgtggtatccagagaaacgaaatcgagcgtggtcaggttctctgc
aagcccggttcaatccacccccacaagaagttcaagggtcaggtttacgtattaaagaaa
gaagaaggcggacgtcatactcctttcttctcaaactacagacctcagttcttcttcaga
acaactgacgttacaggcgttatcacacttcccgctgacaaggaaatgtgcatgcccggc
gataacgtaacaatggatgttgagcttatcactcctatcgctatcgaagaaggtctccgt
ttcgctatccgtgaaggcggcagaactgttggttcaggcgtagttacagctatcaacgaa
taa

DBGET integrated database retrieval system