KEGG   Enterococcus silesiacus: ATZ33_08395Help
Entry
ATZ33_08395       CDS       T04218                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ess  Enterococcus silesiacus
Pathway
ess00500  Starch and sucrose metabolism
ess01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ess00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ATZ33_08395
Enzymes [BR:ess01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ATZ33_08395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: ALS01383
UniProt: A0A0S3KAS1
LinkDB All DBs
Position
complement(1831778..1833265)
Genome map
AA seq 495 aa AA seqDB search
MNNRTILQGFEWYLPADSQHWQRLTELAEELHNMGINGVWLPPAYKGASGVEDVGYGPYD
LYDLGEFDQQGTIPTKYGTIEEYLKCIKTLKANGMEVYGDIVFDHFMGADEEETVSAIKY
RPDNRNEALSGEEEISAWTKFTFPGRNQKYNDYTWTWKNFSGVDFDDRRQDHGIFNFDGK
GWDEEVDNENGNYDYLMGCNLDMEYSETVEQLNRWGQWYQELTDVDGYRLDAVKHIQFNY
FVDWLINRRKEKGNDLFVVGEYWNGELEKLTNYIDSSGTLISLFDVPLHYHFYEAANSDG
HYDMRNIFEGTLAKERSEWAVTFVDNHDTQKGQSLESWVDGWFKVHAYALILLRKAGTPV
VFWGDLFGIPSQGVDAVGKDLELLLKIREQLAYGSEMDYFDDPNVVGWIRTGTFDREQSG
YAVVMTNAQAGEKNMTISAIHAGKIFVDILGNNDTKVTLDETGGGTFPVNGGEVSVYVNE
EIVEKLSRRIDGLTM
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcgtacaattttacaaggatttgaatggtatctgccggcagatagtcaacat
tggcaacgtctgactgaattagcagaagaattacataatatgggaatcaatggcgtttgg
cttccgccagcctataaaggagcaagtggtgtagaagatgtagggtatggaccttatgat
ttatacgatttaggtgaatttgatcaacaaggaacgattccgactaagtacggtactata
gaagagtatttaaaatgtattaaaacattaaaagcgaatgggatggaagtttatggtgat
attgtttttgatcattttatgggagcagatgaagaagagacagtttcagctataaaatat
cgccctgataatcgaaatgaagcacttagtggtgaagaagaaatttcagcatggacgaaa
tttacttttccaggaagaaatcagaaatataatgattatacttggacgtggaaaaatttt
tcaggtgtcgattttgatgatcgtagacaggatcatgggattttcaattttgatggaaaa
ggttgggatgaagaagttgacaatgaaaatggcaattatgattatttgatgggttgtaat
ttagatatggagtattctgaaacagttgagcagttaaatagatggggacagtggtatcaa
gaattgacagatgttgatggctaccgtttagatgcagtaaaacatattcagtttaattat
ttcgtcgattggttaataaatagaagaaaagaaaaaggcaatgatttatttgtcgttggt
gaatattggaatggtgagttggagaaattaacgaattatattgatagttctggaacgttg
atttctctatttgatgttcctttgcattatcatttttatgaggcagcaaactctgacggt
cactatgatatgcgaaatatttttgaaggaactttggcaaaagagcgctcagaatgggcg
gtcacctttgttgataatcatgatacgcaaaaaggccaaagtttggaatcatgggttgat
ggttggtttaaagttcatgcttatgcgttaattttgttgcgaaaagctgggacaccagtt
gtcttttggggcgatctatttggaattccgtctcaaggtgtggacgctgtggggaaagat
ttagaactattgttaaaaattcgtgaacagctagcttacggcagtgaaatggattatttt
gatgatcccaacgtggttggatggataagaacagggacgtttgatcgagagcaatcgggc
tacgctgtcgtaatgaccaatgctcaggcaggcgaaaagaatatgacaatcagtgcgata
catgctgggaaaatatttgttgatattttgggtaataatgatacaaaagtcacattggat
gaaactggtggtggcacatttccagtgaatggcggagaagtttctgtttatgtgaatgaa
gagattgtagaaaaattgagtagaagaattgacggtttgacgatgtag

DBGET integrated database retrieval system