KEGG   Enterococcus silesiacus: ATZ33_11130Help
Entry
ATZ33_11130       CDS       T04218                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ess  Enterococcus silesiacus
Pathway
ess00010  Glycolysis / Gluconeogenesis
ess00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ess00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ATZ33_11130
   00500 Starch and sucrose metabolism
    ATZ33_11130
Enzymes [BR:ess01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ATZ33_11130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Albumin_I_a Glyco_hydro_10
Motif
Other DBs
NCBI-ProteinID: ALS01913
UniProt: A0A0S3KCX4
LinkDB All DBs
Position
complement(2414476..2415882)
Genome map
AA seq 468 aa AA seqDB search
MSKFPKDFLWGGAIAANQCEGAYNEDGKGLSVEDVAPHGWKGLPTSEPTSDNMKLVGIDF
YHRYKEDIKLFAEMGFKVFRLSIAWSRIFPQGDEQEPNEKGLEFYDKVFDECHKYGMEPL
VTLSHYETPLHLSKTYDGWRNRKMIEFFEHYARTVFTRYKGKVKYWLTFNEINSITHAPF
LSGGIYTPKEKLSKQDLYQAIHHELVASARAVKACHELLPDAQIGCMILGMPVYPLTPAP
ADVLASLQTERENFFFSDIQVRGAYPAYAKRFFKENDIHLEITRQDQQDLLETVDFISFS
YYMSTCESSDPSLETGEGNILGGVPNPYLKASEWGWQIDPEGLRYYLNILYDRYQKPVFI
VENGFGAVDELIELKDGTKTVNDDYRIDYLNDHLVQVAEALEDGVEIMGYTSWGCIDLVS
FTTAELKKRYGFVYVDRNDDGTGTLNRYKKKSFNWYKEVIATNGQNLV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaatttccaaaagattttttgtggggcggtgccattgccgctaaccaatgtgaa
ggggcttataatgaagatggcaagggactaagtgtagaagatgttgcgccccatggttgg
aaggggctgccgacaagtgaaccaacctcagataacatgaaactagtcggcatcgatttc
taccatcgatataaagaagatattaagttatttgctgagatggggtttaaagttttcaga
ttatcgattgcttggtcacgaatctttccacaaggtgatgaacaggagccgaacgaaaaa
gggctggaattttacgataaagtttttgatgaatgtcataaatatggaatggagccatta
gtgacattgtcgcattatgaaacaccacttcacttgtcaaaaacctatgatggttggcgt
aatcgtaaaatgatcgagttttttgagcactatgccagaactgtttttacgcgttataaa
ggaaaagtaaagtattggttgacgtttaatgaaatcaattcgattacacatgcgcctttt
ttaagcggaggcatttatacaccgaaagaaaaactatcaaaacaagacttatatcaagca
attcatcatgaattagtagcaagtgccagagcagtaaaagcctgtcatgagctgttgcct
gatgctcaaattggttgtatgattctaggaatgcctgtttatccattgacaccagcacct
gctgacgtgctagcgtcgcttcaaactgaaagagaaaacttcttcttttctgatatccaa
gtaagaggagcttatccagcctacgctaagcgatttttcaaggaaaatgatattcatctt
gaaattacaagacaagatcaacaagatttgctagagacggtagattttatatcctttagt
tattatatgagtacgtgtgaatcctcagatccgtcactggaaacaggagaaggaaatatt
ttaggtggggtacctaatccttatttgaaagcgagcgaatggggctggcaaatcgatcca
gaagggttgagatactatttgaatatcttatatgaccgctaccaaaagcctgtatttatt
gttgaaaatggctttggcgcagtggatgagttgatagagcttaaagatggcactaaaact
gtgaatgatgattatcgtatcgattatttgaatgatcacttagtccaagtagctgaagca
cttgaagatggcgttgagatcatgggctatacttcatggggctgcattgatttagtcagc
tttacaactgctgagctaaaaaaacgttatggttttgtttatgtcgaccggaatgatgat
ggaacaggtactttgaatcgttataaaaagaaaagttttaattggtataaagaagtcatt
gcaacaaatggtcaaaatctcgtttga

DBGET integrated database retrieval system