KEGG   Enterococcus silesiacus: ATZ33_15430Help
Entry
ATZ33_15430       CDS       T04218                                 

Definition
(GenBank) AP endonuclease
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
ess  Enterococcus silesiacus
Pathway
ess00040  Pentose and glucuronate interconversions
ess00051  Fructose and mannose metabolism
ess01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ess00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ATZ33_15430
   00051 Fructose and mannose metabolism
    ATZ33_15430
Enzymes [BR:ess01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     ATZ33_15430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 zf-C2H2_aberr
Motif
Other DBs
NCBI-ProteinID: ALS02716
UniProt: A0A0S3KEI2
LinkDB All DBs
Position
3349406..3350332
Genome map
AA seq 308 aa AA seqDB search
MKLATRINSFLPKFNHDVEEVLQEFNRLGLTHVDFNYPEHVADISAEKMKKMLQENKLKA
NGVALRFRSEFINGELGNADQSISSNAVKLCKEACDYCREVGGEVVTIWLGFDGFDYSFQ
IDYEKVWNQIKACMIEITDYAPDLKISIEYKPFQPRAYAFLDSFGVALSMVHEVGRENLG
ITLDYCHMLMKHENPAYGASILGSRQKLFGVHLNDGYGLNDDGLMIGTSSLIKTIEFIYY
TKLHNYDHAFYFDTFPIIEDPVAECERNINMIKKIDAIIERLGMDYIANVIKQNSAVKVS
DLVLEILA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagcgacaagaatcaattcatttttaccaaaattcaatcatgatgtggaagaa
gtcttacaagaatttaatcgtctagggttaactcatgttgattttaattatccagaacat
gtggcagatatttcagctgaaaaaatgaaaaaaatgttacaggaaaataaattaaaagca
aatggtgtggcactaaggtttagaagtgagtttatcaatggcgagttaggaaatgcggat
cagagtatttctagcaatgcagtcaaactgtgcaaagaagcctgtgattattgtcgtgaa
gtaggtggagaagtcgtgacgatctggttaggttttgatgggtttgattattcattccag
atcgactatgaaaaagtttggaaccaaatcaaagcctgtatgatcgaaattacagactat
gcgcctgatcttaaaatcagcattgagtacaaaccgtttcaaccaagagcgtatgcattc
ttagatagtttcggggtcgctttatcaatggttcatgaggttggtcgtgagaatttaggg
atcaccttagattattgtcacatgctaatgaaacatgaaaatccagcttatggtgcaagt
attttaggcagtcgtcaaaaactatttggggttcatttaaatgatggttatggtctaaac
gatgatggattgatgatcggtacaagtagtttgatcaagacaattgaatttatctactat
acaaaattacacaattatgatcacgctttctatttcgatacatttccaattattgaagat
cctgtagcagagtgtgaaagaaacatcaacatgatcaaaaaaatcgatgcgattattgag
cgattaggaatggactacatcgctaacgtgatcaaacaaaacagcgcagtgaaagtaagt
gatttagtattagaaatcttagcttaa

DBGET integrated database retrieval system