KEGG   Echinicola strongylocentroti: DN752_01995Help
Entry
DN752_01995       CDS       T05506                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
est  Echinicola strongylocentroti
Pathway
est00620  Pyruvate metabolism
est00680  Methane metabolism
est01100  Metabolic pathways
est01120  Microbial metabolism in diverse environments
est01200  Carbon metabolism
Module
est_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:est00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DN752_01995
  09102 Energy metabolism
   00680 Methane metabolism
    DN752_01995
Enzymes [BR:est01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DN752_01995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AWW29004
UniProt: A0A2Z4IDP2
LinkDB All DBs
Position
complement(515187..517736)
Genome map
AA seq 849 aa AA seqDB search
MSNTYQTEVAKRFTIYNSLFLDLPFDDIYRTGTLLPILSSECKKGFTEGKTPKEIINSFF
EGMLASDSSKEKHNLLFQLVQYVERQVVLFDSIEDAAFEKINDVKGKGTMNALISRVETD
KKKAELIEKLRTFSIRLTLTAHPTQFYPGNVLAIITDLESAIRKDDLGSIDALLRQLGKT
AFINKEKPSPYEEAVSLCWFLEHVFYKSIPDIMARVLRRLDIPLHEWDNPDLLKVGFWPG
GDRDGNPFVTHQITMDVADKLQETILRCLYRDVRKVRRRMTFKGVESLMLEAENGIYKTL
YGGEKVLKSKEDLLKILLKAREIIIESHDGLFLDILDEFILKVNVFGFYFASMDMRQDSR
KHAALWEEIIEVTQGKDALKKYQEGNEEEQINTILSFKELPNPKSLKDEFHQEMLESIAS
ISYVQDNNGSEGLHRYIISNCQSELHILQVYQLNKLTLAPKGDLKLDIVPLFETIDDLAA
APEIMERLYSNKVYAAHLKARGKKQSIMLGFSDGTKDGGYIRANWSILRAKEELTNASRK
YEVSVVFFDGRGGPPARGGGNMHNFYASLGDQVENEEIQVTIQGQTISANYGKPVSCTYN
LEQLLSAGLENHLYPTEENRLTDDQRALIDEMADISYQAYKEFKSHPQFVSYLEKVTPLK
FFGKTNIGSRPLKRSKGEAMKFEDLRAIPFVGSWAQMKQNIPGFYGVGKAITEMEKRGKK
DQVTKLYQDSLFFRSLMGNSMQSLAKSYYPATAYLKDDKEYGGFWELMHSEYQQSFKKIL
EISGMNELLEDNAVSSQSIEIREKIVLPLITIQQYAIQEMLETGKEDTVLQKLVLRTMFG
IINAARNAA
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatacctaccagactgaagtagccaaacggtttaccatttacaacagtttattt
ctagacctgccatttgatgacatttataggacagggactttgctcccgatcttgtcttct
gaatgcaagaaaggcttcactgaggggaaaaccccaaaagagattatcaattcatttttt
gaaggcatgttggcctctgattcatccaaggaaaaacacaatttactgtttcagctggtt
caatatgtagaaagacaggttgttctttttgactctattgaagatgctgcatttgaaaaa
atcaacgatgtgaaaggtaaaggtaccatgaacgcgttgatttccagggtggaaacagat
aagaagaaggcagagctgatcgagaagttaaggactttctccattcgtcttaccctgacg
gcccaccctacgcagttttatcctggcaatgtattggccatcattactgatctggaatcg
gctatccgtaaggatgatttgggcagcatcgatgctttgctgaggcagttgggcaagacg
gcctttatcaataaagaaaaaccgtctccttatgaggaagcagtcagcttgtgctggttt
ttagagcatgtattctacaagagtatcccggatatcatggccagggtgcttagaaggctt
gacatccctcttcatgaatgggataaccctgacctgctcaaggtcggcttttggccaggt
ggcgaccgtgacggtaacccgttcgtgacacatcaaatcaccatggatgtggctgataag
ttgcaggaaactattcttaggtgtctgtaccgggatgtcaggaaggtgagaaggagaatg
accttcaaaggggtagagtccctgatgctggaggccgaaaacggtatttacaaaaccctt
tatggaggagaaaaagtattgaagtcaaaagaggacttgttgaagattcttttgaaagcc
agagagatcattatcgaatcgcatgatggactgttcttggatattctggatgagtttatc
ctgaaggtgaatgtgtttggattttattttgcatccatggacatgcgccaagacagtaga
aaacacgcagcgctatgggaagaaatcatcgaagtgacccaaggaaaagatgcgttgaaa
aaataccaggaaggtaatgaggaggagcagatcaatacgattctttctttcaaggaattg
ccaaatccgaagtcactgaaggatgagtttcatcaggaaatgctcgaaagtatagcctct
atcagctatgtgcaggataataatggtagcgaagggctacatcgatatattatttccaat
tgccaatcagagctacacatacttcaagtgtaccagttgaataagcttacactggctccg
aagggagacctgaagttggatatcgtaccgctttttgaaaccatcgatgacttggcagca
gcgccggaaatcatggagcgactttattccaacaaagtatatgctgcacacctgaaggca
agaggcaaaaagcaaagcattatgttaggcttctccgatggtaccaaagacggtggctat
atccgagccaactggtctattttgcgtgccaaggaagagcttaccaacgcttccagaaag
tatgaagtgagcgtggtgttctttgatggtaggggtggacctcctgccagaggtggcgga
aacatgcacaacttctacgcttcgctgggtgaccaagtagaaaatgaagaaatccaagtg
accattcagggacaaaccattagcgccaactatggcaagccggtttcttgtacctataac
ttggagcaattgctcagtgctggattggagaatcacttgtacccaaccgaagaaaacagg
ctgactgatgaccagagggcgttgatcgatgaaatggccgatatcagttatcaggcgtat
aaggagtttaagagccatccacagtttgtgtcctacttagaaaaagtaaccccgctcaag
ttctttggtaagaccaatatcggttcgagaccactgaagagaagcaaaggggaggccatg
aagtttgaagacctgagagccattccttttgtaggatcatgggcacagatgaagcaaaat
attccaggtttttacggagtgggcaaggccatcacggaaatggaaaaaagaggcaaaaag
gatcaggtgaccaagctttaccaagattcccttttcttccgttcgctgatgggcaactcc
atgcagtcactcgctaaatcctactatccagccacggcttatctaaaagacgataaggaa
tatggcggtttctgggagctgatgcattcagaatatcagcagtcattcaagaagatactg
gagatctcagggatgaatgagttactggaagacaatgcagtaagtagccagtctatagag
attcgggaaaagatagtattgccactcatcaccatccaacagtatgctattcaagaaatg
ctggaaacgggtaaggaagatacggtcttgcagaaactggttctaagaaccatgtttggt
attatcaacgcagcaaggaatgcggcgtaa

DBGET integrated database retrieval system