KEGG   Echinicola strongylocentroti: DN752_02140Help
Entry
DN752_02140       CDS       T05506                                 

Gene name
cobT
Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
est  Echinicola strongylocentroti
Pathway
est00860  Porphyrin and chlorophyll metabolism
est01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:est00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DN752_02140 (cobT)
Enzymes [BR:est01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     DN752_02140 (cobT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT TcdB_N
Motif
Other DBs
NCBI-ProteinID: AWW29031
UniProt: A0A2Z4IDB9
LinkDB All DBs
Position
557372..558421
Genome map
AA seq 349 aa AA seqDB search
MIAINISPIDHSLEKALQQKIDLKTKPIGALGDLESLALHIGLIQQSLTPSLRNPHMLVF
AGDHGIAKENLVNPYPQEVTYQMVMNFLGGGAAINVFARQHHLALKVIDAGINYDFGDQP
NLVHAKIAKGTANYLKEPAMTEAQCLDALQKGAELIEQIDRDDCNVVGFGEMGISNTSSA
ALIMHTVCGIPLEECVGKGTSTNDDQQKTKLQTLKKALNIHNKIDRDNAIQILSTFGGFE
IAQLCGAMLKAAERKMVILVDGFITTAAVLIANELHPNFLSYCIFSHCSGERGHAAMLDY
LKAKPLLHLGMRLGEGSGVAIAYPIVASACAFLHEMASFDSAGVSKENH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatagctattaatatttcgccaatagaccattcgctcgaaaaagcactccagcagaaa
atagaccttaaaaccaaacccatcggtgcgctgggcgatctggaaagcctcgctctccac
attggtttgatccaacaatcactcactccttcgctaaggaatccacatatgctggtattt
gccggagaccatgggatcgccaaagaaaacttggtcaacccctatccccaggaagtaacc
taccagatggtcatgaatttcctcggcgggggagcagcgatcaatgtgtttgccagacaa
caccacttggcactaaaagtcatcgacgccggtatcaactatgattttggcgatcagccc
aacttggtccatgcaaaaatcgccaagggaacagccaattacctcaaggaaccggccatg
acagaggcgcaatgcttggatgcactacaaaaaggagccgaactaatagagcagattgat
cgagatgactgcaatgtagtcggctttggcgagatgggcatcagcaacacctcttctgca
gccctcatcatgcataccgtatgcggtattcctttggaagaatgcgtaggaaagggcaca
agcactaatgacgatcaacaaaaaactaaacttcaaacactcaaaaaagcacttaatata
cataacaaaatcgatagggataatgctattcaaattttgagtacctttggtggctttgaa
atagcccagttgtgcggtgctatgctaaaagcggcggaaagaaaaatggtcatattagtg
gatggatttatcaccaccgcagctgtactgattgccaacgaacttcatcccaacttcctt
tcttactgtatttttagccattgttcgggagaaagaggccacgccgctatgctcgactat
ctcaaagcaaaaccactgctccatctaggcatgaggctcggcgagggttctggcgttgcc
atagcctatccgatagtagcttctgcatgcgcctttcttcatgaaatggccagcttcgat
agtgcaggggtaagcaaggaaaatcactaa

DBGET integrated database retrieval system