KEGG   Echinicola strongylocentroti: DN752_04955Help
Entry
DN752_04955       CDS       T05506                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
Organism
est  Echinicola strongylocentroti
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C UDPG_MGDP_dh_N TrkA_N Pyr_redox_2 ApbA 3HCDH_N Pyr_redox FAD_binding_3 2-Hacid_dh_C HI0933_like NAD_binding_7 IlvN Pyr_redox_3 DAO Shikimate_DH NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AWW29530
UniProt: A0A2Z4IFR1
LinkDB All DBs
Position
complement(1274216..1275235)
Genome map
AA seq 339 aa AA seqDB search
MKAAFYQEKGKFTLGDSPVHSPGKGEVRLSVQYCGVCGTDVHIFHGVMDKRVGPPQVIGH
EASAIVAEVGEGVSDIKVGDEVAVRPLRFGADHPFDKGHKHVGKNLKFIGIDSAGAFQQN
WVVPAYTLHKLPEGLSLKHGAFIEPLSVACHDVKIGRVKQGENTLVIGGGPIGTLIAYVL
KDKGANVIISEVNEKRISMLRELGFTVVNPIEQDLKTAISDLTNEKMIDCAFEVSGSKPG
VEAMTEVVNVRGRIVMVAIHGGGPREVDLFKFFWSEIELLGARLYEEEDYDEALHIAASG
AVPFEKLITKVGGLGQIQEIFDEIDQHPAGMKYLIDINQ
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcattttatcaagaaaaaggaaagttcactttaggagattcaccagtacat
agtcctggtaaaggcgaagtaaggctttctgttcagtactgtggtgtttgcggcaccgac
gtacacatctttcacggggtgatggacaagcgtgtagggcctccccaagtgatcggccat
gaagcttctgcgattgtggcggaagttggtgaaggtgtttcggacatcaaggtcggtgat
gaggtagcggtacgccccttaagattcggagcagatcacccatttgacaaaggccataag
catgtcggcaaaaacctgaagtttataggaatagatagtgcaggggcatttcagcaaaac
tgggtagtaccagcatatacacttcataaacttcccgaagggcttagcttgaagcatggc
gcatttatagagcccttgtcagtggcctgtcatgatgtgaaaatcggtagggtaaagcaa
ggagaaaataccttggtaataggtggaggtcccatcggtacactcattgcctatgtgcta
aaagacaagggcgccaatgtaattatttccgaagtaaacgaaaagcgaatcagcatgctg
agggagcttggttttaccgtggtgaatccaatcgaacaagacctgaaaacagccatttct
gatctgacaaatgagaaaatgatcgactgcgcctttgaggtttctggctctaagccaggc
gtggaggcgatgaccgaagtggtcaatgtcaggggaaggatcgtaatggtggccatacat
ggcggcgggccaagggaagttgacctgtttaagtttttctggtccgaaattgaattgctt
ggagccaggctttatgaggaagaggattatgatgaagcgcttcatatcgcggcttcagga
gcggtgccattcgaaaaactcatcaccaaggtgggaggattgggacagatccaggagatc
ttcgatgagatcgaccagcatcctgccgggatgaaatacctaattgacataaaccaataa

DBGET integrated database retrieval system