KEGG   Echinicola strongylocentroti: DN752_13415Help
Entry
DN752_13415       CDS       T05506                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
est  Echinicola strongylocentroti
Pathway
est00380  Tryptophan metabolism
est01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:est00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    DN752_13415 (kynU)
Enzymes [BR:est01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     DN752_13415 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AWW31042
UniProt: A0A2Z4IIS6
LinkDB All DBs
Position
3438133..3439413
Genome map
AA seq 426 aa AA seqDB search
MTAHRYSLAYAQERDREDPLRKFKSRFYFPKVNGEEAIYFCGNSLGLQPKAVKEYLERDL
DSWATKAVDGHFDGEEPWFSVHERSKAALAEIVGAKKHEVVAMGSLTSNLHALMVSFYQP
DGKRNKILTEAGAFPSDMYALETQVKHHGLDPSEAIVEVAPRQGEHTIRTEDILQAISTH
KDELACVMMAGLQYYTGQVFDMKAITKAGHEAGALVGFDLAHAVGNAPLRLHDWVVDFAA
WCSYKYLNSGPGNVAGIFVHERHGDNPKLNRFAGWWGHDEKVRFKMEKGFVPMYGADGWQ
TSNGNVLGMATHQASLDIFKEAGMEALRQKSVQLTGFLEYLIREISGGSGVLEIITPSAE
VERGCQLSLLIHKGGKTVFDEFYRNGIVGDWRNPNVIRIAPTPLYNSFEDVFRFAKILEQ
SLAKFT
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacaccgttatagcttggcctatgctcaggaaagggatcgggaagatccccta
aggaaattcaaaagtagattttactttcccaaggtaaatggtgaggaagccatttacttt
tgtggtaattccctggggcttcagccaaaagcagtcaaagaatacctcgaacgagatttg
gatagctgggcgaccaaggcggtggatggccactttgacggagaagagccatggttttct
gtccacgaaagatccaaagcggccttagcagaaatagtaggtgccaaaaagcacgaagtg
gtcgctatgggcagtttgaccagtaaccttcatgcacttatggtgtccttttatcagcca
gatggtaagcgaaataaaatcttgacagaagcgggggctttcccttcagatatgtatgcc
ctggagacccaggtgaaacaccatggacttgatcctagtgaggcaattgtcgaagtagca
cctaggcaaggagagcataccatcaggacggaggatattcttcaagccatatccacgcat
aaggatgaactcgcttgcgtgatgatggcaggcttgcagtattatactggtcaggtgttt
gatatgaaggcaataacgaaggccggacacgaagccggagccttggtgggctttgatctt
gcccatgctgtggggaatgcacccttacgattacacgattgggtagtggattttgcggca
tggtgcagttacaagtacctgaactcaggcccaggaaatgtggctgggatttttgtgcat
gagcggcatggcgacaatccgaaactgaaccgttttgctggctggtggggccatgatgag
aaagtacgcttcaaaatggaaaagggctttgttcccatgtatggcgccgatggctggcag
acgtccaatggcaatgtgctgggaatggcgacacaccaagcgtcgttggacattttcaaa
gaggcaggaatggaggccttgcgccaaaagagtgtgcagcttacaggttttttggaatac
ctgatccgtgagattagtggtggcagcggggtgctggagatcattaccccgagtgctgaa
gtggagagaggctgccaattgtccctcttgatccataaaggagggaaaaccgtcttcgat
gagttttatcgaaatgggatagtgggtgattggcgaaatcccaatgtgatccggatagca
cctaccccgctttacaatagctttgaggatgtattcagatttgccaaaattttggaacaa
tcccttgctaaatttacttaa

DBGET integrated database retrieval system