KEGG   Echinicola strongylocentroti: DN752_14825Help
Entry
DN752_14825       CDS       T05506                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
est  Echinicola strongylocentroti
Pathway
est00564  Glycerophospholipid metabolism
est01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:est00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DN752_14825
Enzymes [BR:est01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DN752_14825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 HI0933_like NAD_binding_8 Pyr_redox_3 Pyr_redox GIDA Thi4 Abhydrolase_5 Lycopene_cycl NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AWW31296
UniProt: A0A2Z4IL50
LinkDB All DBs
Position
complement(3819884..3821449)
Genome map
AA seq 521 aa AA seqDB search
MNRTSNLRHLTKNQLWDIVIIGGGASGLGVALDALSRGLSVALFERADFAKGTSSRSTKL
VHGGVRYLAQGDILLVWEALRERGRILRNAPHLAHVQPFIIPIYSHATKYYYSVGLKLYD
WMSGWLSLGDSAYISKKETIKRLPQIKKEGLLGGVVYQDGEFDDARLALCVAQTSDDMGG
CILNYMKVNALSKDNNGQTNGVKVRDTINKKTYDVKARMVVNATGVFADKILQMDQKGTP
RMIQPSQGVHLVLPQYFLGGKDALMIPKTSDGRVLFAVPWQGKLVVGTTDTIREKAKLEP
EALSREINFILDTAGHYLQKQPTRKDVLTVYAGLRPLAAPQGGSVKTKEISRNHKVIISE
TGLVTLTGGKWTTFRKMGEDTVDHFSRITGEEIKESRSWEIKFHGYGDPTLDDNHWKSYG
TDAVKVLQLIKDTPAYAKYLHPNYPYVAGEVIWAVREEMAMHIEDFLARRIRILLLDAAA
AMAMAPIVAKLMAEELKKDKKWEESEIAAFNKIAEKYLIKT
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaactagtaaccttcgccatttaacaaaaaatcaactttgggatattgttata
attggtgggggagcctcggggttgggagtcgctttggatgccctatcacgaggtttgagc
gtcgctctttttgaaagagctgattttgcaaaaggcacttccagcagaagcaccaaactg
gttcatggcggtgtgcgctacttggcccaaggggacatacttctggtatgggaagcgctc
cgtgaacggggaagaattttaagaaatgcccctcatcttgcccatgtacaaccctttatc
ataccaatatatagccatgctacaaaatattactattccgtggggctcaaactctacgat
tggatgtctggctggctgagcttgggagactctgcctatatttccaaaaaagaaaccata
aaacggctacctcagatcaaaaaagaggggcttttgggtggggtagtctatcaagacgga
gagtttgatgatgccagactcgccctatgtgttgcccaaacatctgatgacatgggcggc
tgcattctcaactatatgaaagtaaatgccctcagcaaggacaacaatggccaaaccaat
ggtgtaaaagtcagggatactatcaataaaaaaacctatgatgtaaaggccagaatggtc
gtcaacgccaccggagtattcgctgataaaatcctccaaatggatcaaaaaggcactccg
agaatgatccagcctagtcaaggagtccatttggttttaccacagtactttttgggaggt
aaggacgccttgatgatccccaaaacctccgatggcagggtgctatttgcagttccctgg
cagggcaaactggtggtaggaaccactgataccatccgtgaaaaagctaaactagagcca
gaagcactctctagggaaattaacttcatactggacacagctggccattacctccaaaaa
caacctaccagaaaagatgtactgaccgtatatgcaggcctacgaccacttgctgcccca
cagggaggaagcgtaaagaccaaagagatatcccgaaatcacaaagtcatcatctcagaa
acaggcctagtcactttgacaggaggaaaatggacgacattccgcaaaatgggcgaggac
acagtggatcatttttcccgtatcactggagaggaaataaaagaaagccgatcttgggag
atcaaatttcacggctatggtgatcccactttggatgacaaccactggaaatcttatggt
acagatgcagtaaaagtcctccagctaattaaagacacccctgcctatgccaaatacctt
catcccaattacccctatgtggccggagaagtcatctgggccgtaagggaggaaatggcc
atgcatatagaagactttttggccagaaggattcgcatacttttactggatgctgcggcc
gcaatggccatggctcctatagtagccaaactaatggcggaagaattaaaaaaagacaaa
aaatgggaggaaagcgaaatcgctgctttcaataaaatcgctgaaaaatatttgatcaaa
acctga

DBGET integrated database retrieval system