KEGG   Eubacterium siraeum 70/3: EUS_07950Help
Entry
EUS_07950         CDS       T02590                                 

Definition
(GenBank) ATP phosphoribosyltransferase, regulatory subunit
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
esu  Eubacterium siraeum 70/3
Pathway
esu00340  Histidine metabolism
esu01100  Metabolic pathways
esu01110  Biosynthesis of secondary metabolites
esu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:esu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    EUS_07950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: CBK96039
UniProt: D4JSH0
LinkDB All DBs
Position
809395..810615
Genome map
AA seq 406 aa AA seqDB search
MKSYDLITPEGTRDLLFDECVARKEAEDKLRAVFTAHGYSEVITPALEFYDVFNNKTRSF
RQEDMYKLTDGKGRLMVMRPDSTMPIARIVATRLRDGVFPLKLFCSQNIYRCNPKMAGRD
DEFMQSGVEIIGGDEKRSDLEALSLAAQVLNSCSSDDVRLEIGDNTFYKLLLEKLDIDDE
ETVRSLIESKNTPDLTQFIKENVDSNPEKRRYSEILLQLPDLFGGAEVFDKAEKLFAGTA
LSDRLTELKETFDALRKLEAEDKITVDLGLVNKAEYYTGIVFRGYIEEYGQAVLSGGRYD
TLIGSFGADDMPAVGFAVNVNAIAAANLRSNRSTKARHAEVLVFAADEDLIDGISHCTKL
ISKGISAEFSTCPTLDAAMEYAKANKIGRIDIIDKEKNEQPVTMTL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagctacgatcttattacacctgagggtacaagagatctgctgtttgacgagtgt
gtagcccgtaaagaagcagaggacaaattaagagcggtgttcaccgcacacggatacagc
gaagtgattactcctgcgcttgaattttacgatgtgttcaataacaagacaaggagcttc
cggcaggaagatatgtacaagctgacagacggcaagggcagacttatggtaatgcgtccg
gacagtacaatgcctatcgctcgaatagttgcaacaagactgcgtgacggtgttttcccg
ttaaagctgttctgctcgcagaatatctaccgctgtaatcctaaaatggcaggcagggac
gacgaatttatgcagagcggcgttgagataataggcggcgacgagaagcgttccgacctt
gaggcgctcagccttgcggcacaggtgctgaactcctgctcaagcgatgatgtacgtctt
gaaataggagataacacgttctataaactgcttcttgaaaagcttgatattgatgatgaa
gaaacggtaagaagccttattgagtcaaagaacactcccgaccttacacagtttatcaag
gaaaacgttgacagcaatcccgaaaaacgcagatattccgagatacttttacagctcccc
gatctgttcggcggtgcggaggtatttgacaaggctgaaaagctgttcgcaggcacagcc
ctctcagacaggctgaccgagcttaaggaaacgtttgacgcactgagaaagcttgaagca
gaagataagataacagttgacttaggacttgtaaacaaggccgagtattatacgggaatc
gtgttcagaggatatatagaggaatacggtcaggctgtgctttcgggcggaagatatgat
acgcttatcggcagcttcggagcggacgatatgccggctgtaggctttgcggtaaacgta
aacgctattgcggcggctaatctcagaagcaacagaagcacaaaggcacgtcacgcagag
gttctggtatttgccgcagatgaggatctgatagacggtatcagccactgcacaaagctt
atttcaaagggcatcagtgcggagttcagcacctgccccacgcttgatgcggctatggaa
tatgctaaggctaacaaaatcggcagaatagatataatagataaagaaaagaacgaacag
cccgttacaatgacgctgtaa

DBGET integrated database retrieval system