KEGG   Eubacterium siraeum 70/3: EUS_09700Help
Entry
EUS_09700         CDS       T02590                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
esu  Eubacterium siraeum 70/3
Brite
KEGG Orthology (KO) [BR:esu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:esu01001]
    EUS_09700
Enzymes [BR:esu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EUS_09700
Protein kinases [BR:esu01001]
 Serine/threonine kinases: Other
  Bacterial family
   EUS_09700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like DUF3244 APH Pkinase_fungal Methyltransf_20 GAD
Motif
Other DBs
NCBI-ProteinID: CBK96183
UniProt: D4JSW4
LinkDB All DBs
Position
988004..990469
Genome map
AA seq 821 aa AA seqDB search
MDNNTDNMIGRRLDGRYELLELIGTGGMADIYKAKDITEDRIVAVKILKNEFAGSEDFLR
RFRNESKAIALLSHPNIVKIYDVGFNEQIQYIVMEYIDGISLAEYIKLQGVLKWKDAVYF
TIQILRALQHAHDRGIVHRDIKSQNVMMLPDGTIKVMDFGIARFNRETDKTLSEKAIGSV
HYISPEQARGEMTDEKSDIYSVGVMLYEMLTGQKPFDGETPVAIALQHMQTPPKPLREIN
SSIPEGLEEITLKAMQKEPSMRYQTAGEMINDIEEFKKDPSIVFEYKYFSTDGSTKYFDK
VSDPNAPDQNANGDELPESEGEEDNDLYDEDEDDEDEVEERRSPLLPILFAVASVFVIMT
AWLIFTIVSGNLGTESGGSDEMTMPNIVGMMLDDVKTKYPELNLDIDRQYSTEYKENEVM
DQKTPAGRTIKKSTIVNIVISNGPQKVEIDDYSNLTVQDAQIKLEKKGLKPKIVYVNNDD
VAKDIVIKTEPAAHSEVSQGTLVKVYVSNGKLVKAVNVPKFIGMTIEEAREEAEKKNLKL
KEVAGSSNEYEKDQVIKQNIAENSVVNEETEIEVTVCDGKAVNIKAEVSLNLPTDATDTG
TFKFEYFKDGVSFKEEERDMAVNSGKTLTFEVSGTEPATFTVKITNVNDTSLSGVLAEIS
VDFKNEDTEPEIVSYDEGLFKKLKYVAPDTSKDESSSNPEPTEVSGSVTVTLPTNAAQSG
TFNFTYMDSDGNVIKTETKDMSLAAGKPVSFDVSGKDKRTYLIKITNVKDEALTGTLAEI
EIDFSDGTVKQNIISYDQNLFNNLKFISNEASGEHSEETDE
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggataacaatacagacaacatgataggcagacgccttgacggccgttacgagcttctt
gagcttataggaacgggcggaatggctgacatctacaaggcaaaggatattactgaggac
agaatagttgccgtaaaaattcttaagaatgaatttgccggcagtgaggattttctcaga
agattccgcaatgagtcaaaggcaatagcactgctttcgcatccgaacattgtaaagata
tacgatgtcggcttcaacgagcagattcagtatatcgtaatggaatacatagacggcatc
tctcttgccgaatatatcaagctgcagggcgttctgaaatggaaggacgctgtatatttc
actatccagattttaagagcattacagcacgcacacgacagaggaattgtccacagggat
ataaagtcgcagaacgtaatgatgctccccgacggcacaatcaaggtcatggatttcggc
attgcccgttttaaccgtgaaacagataaaactctttccgaaaaggctatcggttcggtt
cactatatcagtcctgagcaggcaagaggcgaaatgaccgatgaaaagagcgatatatat
tctgtcggcgttatgctttatgagatgctgacaggacagaaaccgtttgacggagaaaca
ccagttgcgattgcgctccagcatatgcagactccgccgaaacctctgcgtgagatcaat
tcttcaattcccgaaggtcttgaggagattacgctcaaggctatgcagaaagagccttcg
atgcgttatcagaccgctggcgagatgataaacgatattgaagaattcaagaaagatccc
agcattgtatttgagtacaaatatttctcaacagacggctcgaccaagtatttcgataag
gtatccgaccccaacgctcccgatcagaacgcaaacggagatgagcttcccgaaagcgag
ggcgaagaggataacgatctttatgacgaggatgaggacgatgaggatgaagtagaggaa
agacgttctccgctccttcctattctctttgctgtagcatctgtatttgtaataatgacc
gcatggctcatatttactatcgtaagcggtaacttaggtaccgaaagcggcggctccgat
gagatgactatgccgaatattgtcggaatgatgcttgatgatgtcaagacaaagtaccct
gagcttaacctcgatatagacagacagtattctaccgagtacaaggaaaacgaggtaatg
gatcagaaaactcctgccggcagaaccatcaaaaagagtacaatagttaatattgttatc
agtaacggtcctcagaaggtcgagattgacgattactccaacctgaccgtacaggacgca
cagataaagctcgaaaagaagggccttaagcccaaaatcgtatatgtcaataatgacgat
gtggctaaggatattgttataaagaccgaacctgcggctcattctgaggtttcacagggt
acgcttgtaaaggtatatgtaagtaacggcaagctcgtgaaggcagtcaatgttcccaag
tttatcggtatgacaattgaagaagcaagagaagaagcagagaagaagaatctcaagctg
aaggaagttgccggctcaagcaacgagtatgaaaaagatcaggtaataaagcagaacatt
gcggaaaactctgttgtaaacgaggaaaccgagattgaagtaaccgtatgcgacggcaag
gctgtcaatatcaaggccgaagtttcgcttaatctgccgaccgatgcaaccgatacggga
acgttcaagtttgagtacttcaaggacggcgtttcgttcaaggaagaagaacgtgatatg
gctgtaaattcgggtaaaactctgacatttgaagtcagcggtacagaacctgccacattc
actgtcaagattacgaatgtgaacgacacatcgctcagcggagttcttgcggaaattagt
gttgatttcaagaatgaggacacagagcctgaaatagtaagctatgacgagggtctgttc
aaaaagctcaagtatgtagctcccgatacttcaaaggatgagtcttcctccaatcctgag
cctacagaggtaagcggttcagtaactgttacgcttccgactaacgccgctcagtcaggt
acgtttaactttacctatatggacagtgacggaaatgtgatcaagacagaaaccaaggat
atgtcacttgcggcaggtaagcctgtatcgtttgatgtttccggtaaggataagcgtaca
tatcttataaaaatcacaaatgtgaaggacgaggctcttacaggaacacttgctgaaata
gaaattgatttctcagatggtactgtaaagcagaatattatatcatacgatcagaacctg
tttaacaatctgaagttcatttcgaacgaagcatcgggcgaacattccgaagaaacagat
gaataa

DBGET integrated database retrieval system