KEGG   Eubacterium siraeum 70/3: EUS_15660Help
Entry
EUS_15660         CDS       T02590                                 

Definition
(GenBank) Glycosidases
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
esu  Eubacterium siraeum 70/3
Pathway
esu00500  Starch and sucrose metabolism
esu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EUS_15660
Enzymes [BR:esu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     EUS_15660
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     EUS_15660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: CBK96680
UniProt: D4JUB1
LinkDB All DBs
Position
1581726..1583000
Genome map
AA seq 424 aa AA seqDB search
MAKWLENAIFYEIYPQSFNDTNGDGIGDFQGIIEKLDYIKKTGFNAIWMNPCFDSPFGDA
GYDVRDYKKAAARYGTNDDLKRLFDECHKRGMHILLDLVPGHTSVEHEWFKKSMLPESNE
YTDRYIWTSNIWEQPEGLNCIRGISDRDGSAAVNFFSSQPALNYGYAEPKYAYQQKPTDP
GPMATRAAIKDVMKFWLDMGCDGFRVDMAGSLVKCDPEYKETIKLWQDITGYLKSEYPEA
AMVSEWGEPQYSLQGGFDMDFLLHFGPEGYNSMFRSAEPFFSKRGKGTPAIFAEQYNGYH
EKATTGGGLICIPSGNHDMDRLARGRDEDELKCCFAFLLTMPGAPFVYYGDEIGMNFVEG
LVSVEGGYNRTGSRSPMQWDSTANDGFSTADKSQLYIKQDDAPDRPTVEKQMLDEKSLYN
EIKN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtggttggaaaatgcaattttttacgagatatacccgcaatccttcaatgat
acaaacggtgacggtatcggagattttcagggtataatcgaaaagctggactatatcaag
aaaacaggcttcaacgcaatatggatgaacccctgctttgattcgccattcggtgatgcg
ggctatgatgtaagggactataaaaaagccgccgcaagatacggaacaaacgatgattta
aagcggcttttcgatgagtgccataagcgtgggatgcacattcttctcgaccttgtaccc
ggtcacacttcggtagagcatgaatggttcaaaaagtcgatgctccccgaaagcaacgag
tataccgacagatatatctggacaagcaatatatgggaacaaccggagggccttaactgt
ataagaggcatatcagaccgtgacggcagtgccgcagtcaacttcttctcatctcagcct
gcgctgaactacggctatgccgagcctaagtatgcttaccagcaaaagcctacagatccg
ggacctatggcgacaagagccgcaatcaaggatgttatgaagttctggcttgatatgggc
tgtgacggtttcagagtggatatggcaggctcgcttgtaaaatgcgatcccgaatataaa
gaaacaatcaagctatggcaggatataacgggttatcttaaaagcgaatatcccgaagcc
gctatggtatctgagtggggcgagccgcaatattcgctgcagggcggctttgatatggac
ttcttactgcactttggtcctgagggctacaactcgatgttcagaagcgctgagccattc
ttttcaaagaggggcaaaggtactcccgcaatatttgccgagcagtacaacggctatcac
gaaaaggcaacgacaggcggcggacttatctgcattccgtcaggcaatcacgatatggac
agacttgcaagaggcagggatgaggacgagctgaaatgctgttttgctttccttctcaca
atgcccggcgcaccgtttgtatactacggcgatgagatcggaatgaattttgtagaaggg
cttgtatcggtagagggcggctataaccgcaccggatcaagaagtcctatgcagtgggac
agcaccgcaaatgacggattttcaactgcggacaagtcacagctttatataaagcaagat
gacgcacccgacagacctactgtcgaaaagcagatgctcgatgaaaagtcgctctacaat
gagataaaaaactga

DBGET integrated database retrieval system