KEGG   Eubacterium siraeum 70/3: EUS_22060Help
Entry
EUS_22060         CDS       T02590                                 

Definition
(GenBank) DpnII restriction endonuclease.
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
esu  Eubacterium siraeum 70/3
Brite
Enzymes [BR:esu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     EUS_22060
Prokaryotic defense system [BR:esu02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    EUS_22060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII
Motif
Other DBs
NCBI-ProteinID: CBK97211
UniProt: D4JVU2
LinkDB All DBs
Position
2272724..2273584
Genome map
AA seq 286 aa AA seqDB search
MAIRNFNEWLSKFRSSIANYGYYIDFDKVYRNVNDIKVELNILNSLIGSTDIENDFKNII
TKYPETLKCIPILLAVRANEIYAIDGDGEFSYNFKKAKYSPEQYAVFMRKTGLFELLEKH
IIHTLVDYVTGVETGLDSNGRKNRGGHLMEDLVESYIVKAGFEKNKTYFKEMYIHEITEK
WGIDLSAISNSGKMEKRFDFVIKTDKAIYGIETNFYASGGSKLNETARSYKQIAQEVATI
NGFEFVWFTDGSGWTSARHNLEETFDVMEHIYSIDDLEKGILSELL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcaatacgcaacttcaatgaatggctctcaaaattccgaagtagcattgcaaactat
ggatattacatagattttgacaaggtgtatcgtaatgtcaacgatataaaggtagagctt
aacattcttaattctcttattggttcaacagatatagagaacgattttaagaatattatt
accaagtaccctgagacattgaagtgtattcctattctgcttgcagtaagggctaacgag
atctacgctattgacggcgatggtgagttttcgtataatttcaagaaggctaaatactct
ccggaacagtatgcagtatttatgcgtaaaaccggattgtttgaactgcttgaaaaacac
ataattcataccctcgttgattatgttaccggtgttgaaaccggactggactcaaacggt
cgcaaaaatcgtggtggtcatctgatggaagatttggtcgagagctacattgttaaagcg
ggctttgagaagaacaagacctatttcaaggagatgtacattcacgagattaccgagaaa
tggggtattgacctttctgctatttcaaacagcggtaaaatggaaaagcgtttcgatttt
gttatcaagaccgataaagctatctacggaattgaaacgaatttctatgcgagtggcggc
tcaaagctgaacgaaactgctcgcagctataagcagatagcacaggaggttgctaccata
aacggctttgaatttgtatggttcaccgatggttcaggatggacaagcgcaagacataac
ctagaggaaacttttgacgttatggagcatatctactcaattgatgatttggagaaagga
atattgagtgaattattatga

DBGET integrated database retrieval system